KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000394
Entry
CpipJ_CPIJ000394  CDS       T01079                                 

Name
(GenBank) G-protein, gamma-subunit
  KO
K04547  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    CpipJ_CPIJ000394
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cqu04031]
    CpipJ_CPIJ000394
GTP-binding proteins [BR:cqu04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    CpipJ_CPIJ000394
SSDB
Motif
Pfam: G-gamma
Other DBs
NCBI-ProteinID: EDS37602
VectorBase: CPIJ000394
UniProt: B0W030
AA seq 72 aa
MDPSILATMDRDALKKQIENMKYQASMERWPLSKSIAAMREYVEENEKNDPLIHAPDKKN
NPWAEKGKCVIM
NT seq 219 nt   +upstreamnt  +downstreamnt
atggatcccagtattctagcaaccatggaccgtgacgcactcaagaagcagatcgagaac
atgaagtaccaggcctcgatggagcggtggccattgtccaagagcatcgccgcgatgcga
gagtacgtggaggaaaacgagaagaacgatccgctgatccacgcgcccgacaagaagaac
aacccgtgggcggagaagggcaaatgcgtcatcatgtaa

DBGET integrated database retrieval system