KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000949
Entry
CpipJ_CPIJ000949  CDS       T01079                                 
Name
(GenBank) structural maintenance of chromosomes smc4
  KO
K06675  structural maintenance of chromosome 4
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ000949
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin I
    CpipJ_CPIJ000949
   Condensin II
    CpipJ_CPIJ000949
SSDB
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_23 AAA_15 Tropomyosin AAA_29 DUF3450 APG6_N TMF_DNA_bd ATG16 SbcC_Walker_B
Other DBs
NCBI-ProteinID: EDS26587
VectorBase: CPIJ000949
UniProt: B0W1N5
AA seq 1362 aa
MSKNKRRSGGGQAAAAESAQQQQQPPPEAMEVDADDANLSEDEEGGTRVGGIYIPPPVPP
YCSTECKGPRLIISNISNYNFKSYAGHVMLGPFHQRFSAIIGPNGSGKSNVIDSMLFVFG
YRAQKIRSKKLSVLLHSSSKHPNTQSCTVGVHFQQILDREDGSFEVVPNTEFVVARTASR
DNSSYYTIDNRKVHFKEVSKLLKQHGIDLDHNRFLILQGEVESISMMKPKALTENDCGLL
EYLEDIVGTTRYKQPLVKINERVEALNEERTEKHNRCKLAEREMKDLEKPMNEAVEYLKL
ENSLTRTRNQQIQKYLSEQKKKIVELDQERDQAAAILTKHDETFEALKKERIEKENLVKE
EIKQYDSLVKAKEDKEAALKSSLDKYTKVQANMKATNERRKKTMTQIETEKKKLHELQAV
PEKNAKEITESEKKIESLTRQKTDLETTLAENLTTLKDETQPLLEQKEQLQTELIDLKKA
VDDSKSALALAESELKICQHNETTEKRKLETLKYSYEESAKSHQEKQTRLQELEQSFPQL
QQDFTAAQNKLKENVTEEKDLRNQLRTIQGKLQESMQSMQATRSQGKVLDALMRQKNEGR
IPGILGRLGNLGGIDSQYDVAISTCCGHLDFIVVETVNDAQACIDFLKKHDIGRASFVAL
EKIQQYQQYCHNRIQTPENVPRLFDLVRVEDERVLPAFYFALRDTLVAENLDQGQRIAYG
ARRYRVVTLNGDVIETSGTMSGGGRSQQRGRMGTKVQTKTSASDTPSKSNREVEQLQVKA
QEIQSQINYLQEQQGELEQEIQRLSMQLKQQQNEIKRLKMDVNSLSEQLPRLKDQVDWQE
EKVGQTHSDPEKVRALEAKVQECKEEHKTSSDAANEIQKKVDQITAQINDITNSKVKNLQ
TKISSLTKQIDKLTTNISKLTVEIKTSERNVKKAEDKIKSMEEEVVAAQEAIRAGNDERE
KLDEEASALKTEIDELKVEIEKAHEGSSGIKKEIVAIQKKEGEGKMKRLEFEQIVQAIEK
KLGEVKDTIPHWRNKLKPLKLHEIPGETAPEPLKEYTEEELEGYKLADLQYQISIQEEKL
NASKPNLSVIEEFLKKQEAYLQRVAILEEITAKRNEMRQLYDDVRKKRFTEFMQGFHIIT
KKLKEMYQMITLGGDAELELVDSMDPFNEGIVFSVRPPKKSWKMISNLSGGEKTLSSLAL
VFALHYYKPSPLYVMDEIDAALDFKNVSIVAHYIKERTKNAQFIIISLRSNMFELSDYLV
GIYKVTDCTNSVTIKNDPPKFHQMSSQTQQSFSYNPNLSLQSDSGLLEQTKDEIKDEDEG
PTKEKDVDESDGGGGGGGGGTSSSVALDQSSIVSPQPMDVSS
NT seq 4089 nt   +upstreamnt  +downstreamnt
atgagcaaaaacaaacgccgctcgggaggcggccaagctgcggcggcggaatccgcccag
caacagcagcaaccgcccccggaggccatggaggtggacgcggacgacgccaatttgtcc
gaggatgaggaggggggaactcgcgtcggagggatctacattccgccaccggtgccgccg
tactgttcgacggagtgcaagggaccgcggttgattatttcaaacatatcgaattataac
tttaagagttatgcggggcacgtgatgttggggccgtttcaccagcgcttctcggcgatt
atcggtccgaacgggagtggcaagagtaatgtgatcgattccatgttgtttgtgtttggg
tatcgggcgcagaaaattcggagtaagaagctgtcggtgctgttgcacagttcgtcgaag
catccgaacacgcagagctgcacggttggggttcactttcagcagattcttgaccgggag
gatggttcgtttgaggtggttccgaacacggagtttgtggtggcgaggactgcgtcgcgg
gacaattcgtcgtactatacgattgataatcggaaggtgcactttaaggaggtgtcgaag
ttgctgaagcagcacgggatcgatttggaccacaatcggttcctgattctgcagggcgag
gtcgagtcgatttcgatgatgaagccgaaggcgctcacggagaacgattgcgggttgttg
gagtatttggaggacattgtgggaacgacgcggtacaagcaaccgttggtgaagatcaac
gagcgcgtcgaggcgctgaacgaggaacgaaccgagaagcacaaccggtgcaaactggcc
gagcgcgagatgaaagacctggaaaagccgatgaacgaagccgttgagtacttgaagctg
gagaattccctcactcgcacccggaaccagcaaatccaaaagtatctcagcgagcaaaag
aagaagatcgtcgagctggaccaggaacgggaccaggccgcggcgatcctcaccaaacac
gacgaaacttttgaagcgctcaaaaaggaacgcatcgagaaggaaaatctcgtcaaagag
gaaatcaagcagtacgactcgctggtcaaagcgaaggaagacaaagaggccgccctcaag
tcctccctggacaaatacaccaaggtccaagccaacatgaaggccaccaacgagcggcgc
aaaaagaccatgacccaaatcgaaaccgagaaaaagaaactccacgaactccaagccgtc
cccgaaaagaatgccaaggaaataaccgaatcggaaaagaaaatcgaatctctcacccgg
caaaagaccgaccttgaaacaaccctcgccgagaatctcaccacactcaaggacgaaacc
cagcccctgctcgagcaaaaagagcaactccaaaccgaactgatcgacctgaaaaaagcc
gtcgacgactccaaatccgctctcgccctcgccgaatccgagctcaaaatctgtcaacac
aacgaaaccaccgaaaagcgcaagctcgaaaccctcaaatactcctacgaagagtccgca
aaatcccaccaggaaaagcaaacgcgcctccaagaactcgaacaatccttcccccaactc
cagcaggacttcaccgccgcccagaacaaactcaaagaaaacgtcaccgaagaaaaggat
ctccgcaaccaactccgcaccatccaaggcaagctccaagagtcgatgcaatcgatgcag
gccacacgctcccaaggcaaagtcctggacgccctgatgcgacagaagaacgaaggcaga
atccccggaatcctgggtcggctgggaaatctcggtggaatcgactcgcagtacgatgtg
gccatctcgacgtgctgtggccacctggactttatcgtcgtggagacggtgaacgatgcg
caggcttgcattgactttttgaagaagcacgacattgggcgggcgtcgtttgtcgcgctg
gagaagattcagcagtatcagcagtattgtcacaaccggatacagacccccgaaaacgtg
ccccgtctgttcgacctggtccgcgtcgaggacgaacgcgtcctgccggcgttctacttc
gccctgcgggacaccctcgtcgccgagaacctggaccagggccagcgcattgcgtacggc
gcccggcggtatcgcgtggtcaccctgaacggggacgtcatcgaaacgagcggaaccatg
tccggcggtggccggtcgcagcaacggggccgcatgggaaccaaggtccaaacgaagacg
tcggcgtcggacactccgagcaagtcgaaccgggaggtcgagcagctgcaggtgaaggcg
caggagattcagtcgcagatcaactacctgcaagagcagcagggcgagctggagcaggag
attcagcggttgtcgatgcagctgaagcagcagcagaacgaaattaaacggttgaagatg
gacgtgaacagcttgtcggagcagctgccccggctgaaggaccaggtggactggcaggag
gaaaaagttggccagacgcattcggatccggagaaggtgcgcgcgctggaggccaaggtg
caggagtgcaaggaagagcacaaaacgtcgagcgacgcggccaacgagatccagaagaag
gtggatcaaatcaccgcccaaatcaacgacatcaccaacagcaaggtgaagaatctgcag
acgaagatctccagtctgacgaagcaaatcgacaaacttacgacgaacatctccaaactg
acggtggagatcaaaacgtcggaacggaacgtgaagaaagctgaggacaaaatcaagagc
atggaggaagaggtggtggccgcgcaggaagcgatccgggccggcaacgacgagcgggaa
aagctggacgaggaagcgagcgcgctgaagacggaaattgacgagctgaaggttgagatc
gaaaaggcgcacgagggttcgtccgggatcaagaaggagattgtggcgatccaaaagaag
gaaggggagggcaaaatgaagcggctggagtttgagcagattgtgcaggcgatcgagaag
aagctgggcgaggtgaaggacactataccgcactggaggaataagctgaaacccctcaaa
ctgcacgaaatcccgggcgaaaccgctccggaacccctcaaagagtacaccgaggaggag
ctggaaggctacaagctggccgacctgcagtaccagatctcaatccaggaggaaaagtta
aacgccagcaagccgaacctgtccgtgatcgaggagttcctcaagaagcaggaagcgtac
ctgcagcgagtggccatcctggaggagatcacggccaagcgtaacgaaatgcgccagctg
tacgacgacgtgcggaagaagcgcttcaccgagtttatgcagggattccacatcattacg
aaaaagctgaaggaaatgtaccagatgatcacgctgggcggtgacgccgagctggagctg
gtcgactcgatggatccgttcaacgagggtatcgtgtttagcgtgcgaccgccgaagaag
tcgtggaagatgatctcgaacctttcgggcggggagaagacgctttcgtcgttggcgctg
gtgtttgcgctgcactactacaagccgtcgccgctgtacgtgatggacgagattgacgcg
gcgctggactttaagaatgtgtcgattgtggcgcattacattaaggaacgcacgaaaaac
gcccagttcatcatcatctcgctgcggtcgaacatgttcgagctgtccgactacctggtc
ggcatctacaaggtgacggactgcaccaactccgtaacgatcaaaaacgatccgcccaag
ttccatcagatgtcctcgcaaacgcagcagtccttttcgtacaatcccaatctcagcctg
cagtccgactcggggctgctggagcaaaccaaggacgagatcaaagacgaagacgaagga
cccacaaaggagaaggatgtggacgagagtgacggaggtggcggcggcggcggtggaggg
accagcagttcggttgcgctcgaccaatcgtcgatcgtttcgccccaaccgatggacgtt
tccagctga

DBGET integrated database retrieval system