KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001617
Entry
CpipJ_CPIJ001617  CDS       T01079                                 
Name
(GenBank) nicastrin
  KO
K06171  nicastrin
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    CpipJ_CPIJ001617
SSDB
Motif
Pfam: Nicastrin Ncstrn_small Peptidase_M28
Other DBs
NCBI-ProteinID: EDS31216
VectorBase: CPIJ001617
UniProt: B0W373
AA seq 708 aa
MGSPQVTNLRQWPTLLLLLVIAASVQNADSQRIKDNMYASISGAHCFRRLNGTHVTGCSS
RQGGSIGVLHLVRSVADIDFVVEQHPAGPYAPVIPPHLFTRENILRLRDQGGEHVSAVVL
INNASELVQYSQESRCPNQFSGLISGTPDSCSVERPERSWNPWGTGLLLEDFPFPIYYVP
HPEEIQKMVDCFAKFNNFDLENQHRRSLCSIEIKSFMSAAVDSRVCLARSIFFNSLNPVK
FCDPLQGKNVFATLFPRVQVKLEDRKVDLNERIILVSSRMDTTTMFDGVGVGAMDSLVPF
AVLVSVSHFLAKILPKRLQDDNPNVLFMFFNGESYDYIGSQRFVYDLQKGAFPTKGGLTN
PLSLDNIDLMIDLGTFDDPNNLRIYHASELATVPQIAQAIDQINRKWNLNVTAEAPILTK
NLPPVSSNSFLRENASFPSVVVTSAPGNRYYHSIYDDSENLKFVYGNHSRTRDFTELENL
QQTIVDFPTNSIQMRLRNVSTLLGMTLYELVTKTAYPGTLGTSPYLIDEFLYCFLQSADC
PLFMAAVKPDFPRPFPISPQRYISVHSTLPSEASSWTIRLLGFLIGQPLPNDTNTSRADC
QALHLPYNWFAGYSGHGECRLTTQNFSQASSPAFLDDDYDFRSGRYSTWTESTWREMSAR
IFLQPAASHETLTLSIGFVVMLLSFVLVFLINSRSEVLFNQCGASTVP
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgggttcgccacaagtgaccaacttgcggcagtggccgaccctgctgttgctgctggtc
atcgccgcctccgtccaaaacgccgactcgcagcgcatcaaggacaacatgtacgcgtcc
atcagcggggcgcactgcttccggcggctcaacggaacgcacgtcaccgggtgcagctcg
cggcagggcggatcgatcggggtgctgcacctggtccgttccgtggcggacattgacttt
gtagtggagcaacatccggcgggcccgtacgcgccggtcattccgccgcacttgtttacg
cgggagaatattctgcgattgagggaccagggcggcgagcacgtttcggccgtcgtgttg
atcaataacgcgtcggagctggttcagtacagccaggagtcgcgctgtccgaaccagttt
agcgggttgatttccggaacgccggacagctgcagcgtcgagcgaccggagaggagttgg
aatccatggggcacgggactgctgctggaggatttcccctttcccatctactacgtgcca
catccggaagagatacagaagatggtggattgctttgccaagtttaacaactttgacctg
gagaaccaacaccggaggagtttgtgtagcatcgagatcaaatcgttcatgtccgcggcg
gtcgattctcgagtctgcttggcgcggtcaatatttttcaactcgctgaatccggtaaaa
ttttgcgacccgctgcaaggcaagaacgtctttgctacgctgtttccccgcgtgcaggtc
aaactggaggaccgcaaagtggacctgaacgagcgcatcattctggtttcgtcccgcatg
gacacaacgaccatgtttgacggcgttggcgtcggtgcgatggactcgctggtcccgttc
gcggttctcgtgtcggtttcgcacttcttggcgaagattctgcccaagcgactgcaagac
gacaatccgaacgtgctgtttatgttcttcaacggcgagtcgtacgattacatcggttcg
cagcgctttgtgtacgatctacagaagggagcattccccaccaaaggaggtctcacgaat
cctctctcgctggacaacattgatctcatgattgacctgggcacgttcgacgatcccaac
aacctccgaatctaccacgcgtcagagttggccaccgtgcctcaaatagcgcaggcaatc
gaccaaataaaccgcaaatggaacctgaatgtcaccgcagaggcacccatcctgacgaag
aacctcccgccagtgtcttcgaattcattcctgcgtgaaaatgcctccttcccatcggtg
gtggtcacgtccgccccaggaaatcgctactaccactcaatttacgacgacagcgaaaat
ctcaagttcgtctacggaaatcactcccgcactcgcgactttaccgagctcgaaaatctc
cagcaaactatcgtcgacttccccaccaactccatccaaatgcgcctgcgtaacgtctca
accctgctcggaatgacgctctacgaactggtcaccaaaaccgcctaccccggaactctc
ggaacgagcccctacctgatcgacgaattcctctactgcttcctccaatcagccgactgt
cccctcttcatggccgccgtcaagccggacttcccccgccccttcccaatctccccccag
cggtacatcagcgtccactcgacgctcccctcggaagcatccagctggacgatcaggctg
ctcgggttcctcatcgggcaacccctcccaaacgacaccaacacgtcccgtgccgactgc
caggcccttcacctgccgtacaactggttcgccggctattccggccacggtgagtgccga
ctgaccacccagaactttagccaagcctcgtcgccggccttcctggacgacgattacgac
ttccggtcgggccggtactcgacctggaccgagtcgacctggcgggagatgtcggcgcgg
attttcctgcagccggcggccagccacgagacgctgacgctgtcgatcgggttcgtcgtg
atgctgctgtcgtttgtgctggttttcctgattaatagccggtccgaggtgctgttcaac
cagtgcggagcgtccacggtgccgtga

DBGET integrated database retrieval system