KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001771Help
Entry
CpipJ_CPIJ001771  CDS       T01079                                 

Definition
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00061  Fatty acid biosynthesis
cqu01100  Metabolic pathways
cqu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CpipJ_CPIJ001771
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     CpipJ_CPIJ001771
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     CpipJ_CPIJ001771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Methyltransf_11 Methyltransf_PK RmlD_sub_bind NAD_binding_10 Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 6032925
NCBI-ProteinID: XP_001843445
VectorBase: CPIJ001771
UniProt: B0W411
AA seq 246 aa AA seqDB search
MSGPLAGRLALVTGAGSGIGRITSQLLARDGAVVVAVDRNLQAVEETIKSLGGQNDNTAL
EMDVSSSASISQVLDATLAKYKNPPTIVVNSAGITRDNFLLKMPESDFDAVINVNLKGTW
LMLQQFGKAMIDAKLTGSMVNVSSIVARSGNIGQSNYSPSKAGVEAMTKVVAREFGRYNI
RVNAVVPGFIETPMTNDLPQKVKDMVVMQCALRRFGKPQEIAEVIAFLASDKSSYMNGTS
VEVTGG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaccattggcaggacgtttggcgctggtgactggtgcgggatcgggaatcggt
cgcatcaccagtcaactgctggcccgtgatggtgccgttgtcgtggcggtcgatcgtaac
ctgcaggccgtcgaggaaaccatcaaaagcctcggagggcagaatgacaacacggccctg
gagatggacgtctcgtccagtgccagcatctcgcaagttcttgacgccaccctcgctaag
tacaagaatccaccgacaatcgtggtcaactcggccggtatcacgcgggacaatttcctg
ctcaagatgcccgagtccgactttgatgccgtgatcaacgtcaatcttaagggaacgtgg
ttgatgctgcagcagtttggcaaggccatgatcgatgccaagctgaccggatcgatggtg
aacgtatcgtcgatcgtggctcgcagcggaaacattggccagtccaactattcgcccagc
aaggccggcgtcgaagcgatgaccaaggtcgttgcacgcgagtttggccggtacaacatt
cgcgtcaacgccgtcgtgcccggattcatcgagacgcccatgacgaatgacctgccccag
aaggtgaaggacatggtcgtcatgcagtgtgccctgcgccggttcggaaagccccaagaa
atcgccgaagtaattgcgttcctagcgtcggacaagagcagctacatgaacggaacgtcc
gttgaagttactggaggataa

DBGET integrated database retrieval system