KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002055Help
Entry
CpipJ_CPIJ002055  CDS       T01079                                 

Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    CpipJ_CPIJ002055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B TPR_MLP1_2
Motif
Other DBs
NCBI-GeneID: 6032782
NCBI-ProteinID: XP_001843323
VectorBase: CPIJ002055
UniProt: B0W3N9
AA seq 1625 aa AA seqDB search
MCSSYKKWSYFTLSYTVAFITLAICATQASETTHYLPPLECYDPYGRPQRCIPEFENAVY
QVEIEATNTCGEDGDTNFCVQTGYSNRKSCDDCRAGQHSPDYLTDLHDPTNPTWWQSETM
FEGIQYPNQVNLTLKLGKSFDITYIRIVFYSPRPESFAIYKRVSPNGPWIPYQYYSATCR
DTYGLPDSLSVMKGEDESRALCTSEYSDISPLRDGNIAFSSLEGRPSAINFEHSIELQQW
VTATDIRITLDRLNTFGDEVFGDAQVLKSYFYAIADIAVGARCKCNGHASECVTSTNSNG
QRGRVCKCQHYTDGPDCEKCLPFYNDSPWGRATSKNVHECKPCNCNGYSTKCFFDRQLYN
LTGHGGHCIDCGANRDGPNCERCKENFFMREDGYCINCACDPVGSRSLQCNAEGKCQCKP
GVTGDKCDRCENNFYNFGHHGCQPCNCDVRGSLENAPSCDPVNGICSCKENVEGRHCREC
RPGYFNLDLENKFGCTPCFCYGHTSECTSAAGYSIVSTTSNFNKHKEKWSAITATGNPVD
IKYNAKSQTIGVGAQGYDAIYFLAPDRFLGDQRASYNRLLKFRLQLVGQTRPDVSTFDII
LQGANSSISLPIFAQNQPMPDDEFKEFSFRLHEYPEYSWQPSMSARGFMSILSNLTAIKI
RAIYSDYGEAFIDDVELQTAHRGAAGRAATWIEQCTCPEGYLGQFCESCAPGYRHNPALG
GPFMPCIPCDCNKHAEICDSETGRCICQHNTAGDTCDQCAKGYYGNALGGTPYDCKRCPC
PNNGACMQMADESVICLECPVGYFGPRCELCSDGYFGDPTGVHGAIRMCQACDCNGNVDP
NAVGNCNRTTGECLKCIHNTAGLHCDQCLPGHFGDPFALPHGNCEECSCYPRGTEQTDKG
ISICDPNNGNCQCKPNVIGRNCNECKNGYWNIISGNGCENCNCDPTGSYNSSCDTYTGEC
YCKPGIIGKKCDQCALAHYGFSSEGCKSCDCDPSGSKGSQCDQFGQCPCNDNVEGRRCDR
CKENKFDRHQGCLDCPACYNLVQEAANEHRGKLANLNKILQDIQSKPIVIDDNEFVSKLR
TVQDKIDILVEDAKSGSGGGEKTLNEMLQDLEKRLEIVRDLLSKADESQESTEVKNSRGA
NNATIANNQIQDARRELEAAIDLLQTDGAAALSKARDISGHLGNQTNQISGISREARQYA
DQFKKEAEENKKQAEEAHKKASEAHLLAKTTINLQAQIGEEFRTNISNEVQQAKEKLNTV
SKLTDQALTKANEVYDESLSLFVAVNSVSPPSINIDHIKKESNKYNKEADKINADLEKTI
EDHQALLTDVSENIELANTLLERAESQKFDAINAVKELEDAKELAVKAVAEGDGTLKKAN
FTYHTLSGFKNQVDESKQKAADALESVPSIKRQIDNAIELIANSEAALRSANHNALEARN
NAQSAQKKYAEEASKLADSIKKRANTTKNTARDLRHEADQLNGRLAKTENSLAERETNIR
KDFNLTKEAKEKVGQAQLNSNEAKSQVEKAMKEVKAIIDELADLRDIDIKSLNALDDRLT
AAEKELEDAKLTHKLHVLNESKNLQTQNIKSYQREIAELENEVANIKMISDSLPENCYKR
TRLEP
NT seq 4878 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcatcatacaagaaatggtcatatttcaccttgagttatacggtagcattcata
actttggcaatatgtgcaacgcaagcaagtgaaacaacccactatttgccaccacttgaa
tgttacgatccgtacggaagaccgcaacgttgtataccagagtttgagaatgccgtgtac
caagtagagattgaagcaaccaacacatgcggtgaagatggagacactaatttttgtgtt
caaacaggctattccaacagaaaaagttgtgatgattgtcgggctggacaacattctccg
gattatttaactgacttacatgatcctaccaatccaacatggtggcaatccgaaaccatg
ttcgaaggaatccaatatccaaatcaagtgaacttaaccttaaagctaggcaagtcattc
gacataacttacattcgaattgtgttttactcaccacgtccggaatcatttgcaatttat
aaaagagtttcaccaaatgggccatggattccgtatcaatactacagtgcaacctgtcga
gatacttatggattaccagattctctgtctgtcatgaaaggcgaagacgaatctcgtgcg
ctttgcactagcgaatacagtgatatttcgccacttcgggatggcaatatcgcattttct
tcacttgaaggtcgacccagtgccatcaattttgaacacagtattgaattacagcaatgg
gtaactgctacagatattcgcataacattggatcgtctcaacacttttggtgacgaagtt
ttcggcgatgcacaggtgttgaaatcatatttttatgcgatagcagatattgctgttggt
gcgaggtgtaaatgtaatggtcatgccagtgaatgtgtaacaagtaccaattcaaatgga
caacgaggacgcgtatgtaaatgtcaacactataccgatggaccggattgcgaaaaatgt
cttccattctacaatgattcaccttggggacgagcaacatcgaaaaatgttcacgagtgc
aagccctgtaactgtaatggatactcaaccaaatgtttctttgatcggcaactatacaat
ctgactggtcacggtggtcattgtattgattgtggtgccaatcgcgatggaccaaactgc
gaaagatgtaaggaaaatttcttcatgcgtgaagatggctactgtatcaactgtgcttgt
gatccggtcggttctcggtcattacaatgtaatgctgaaggaaaatgccaatgcaagcca
ggcgttactggagacaagtgtgatcgctgtgaaaataatttctataattttggtcaccac
gggtgccagccgtgcaattgtgatgttcggggttcactagaaaacgcgccatcctgtgat
cctgtaaacggtatttgctcatgtaaagaaaatgttgaaggtcgtcattgtcgcgagtgt
agaccaggttactttaacttggatttggagaataaatttggttgtaccccatgcttttgt
tacggccataccagtgaatgcacaagtgccgcaggatactcaatcgtgtcaacaacatca
aatttcaacaagcataaagaaaaatggtctgccattacagccactggaaatcctgtcgat
ataaagtacaatgccaaaagtcaaacaattggagttggagctcaaggatatgacgcaatt
tactttcttgcacctgatcgtttccttggcgatcaacgcgcttcgtataacagattgctc
aagttccgtttgcaactcgtaggccagactagaccagatgtcagcacttttgatataatt
ttgcaaggagccaacagcagtatttcactgccaattttcgctcaaaatcaaccaatgccc
gatgatgaattcaaagagttttcgtttaggctccacgaataccccgaatattcttggcaa
ccatctatgtcagccagaggcttcatgtccattttaagtaacctaacggcaatcaaaata
cgagcaatctattcggattacggtgaagcattcattgacgacgtagaacttcaaacagcg
catcgaggtgctgcaggtcgtgcggcgacctggatcgaacaatgtacatgccctgaagga
tatcttggccaattttgcgagtcgtgtgcacctggttatagacataatccagcgttaggg
gggccgtttatgccatgtattccctgtgattgtaacaagcatgccgaaatttgtgattct
gaaacaggaagatgtatttgccaacataacacagccggtgatacatgcgatcaatgtgct
aaaggatattacggaaatgcgttaggaggaacaccctacgattgtaaacgatgtccttgt
cctaacaatggtgcatgtatgcagatggctgacgagtcggttatttgcctcgaatgtccc
gtcggctattttggaccacgttgtgagttatgctcagatggatattttggagacccaacg
ggagtacacggagccattcgtatgtgccaagcttgtgattgcaatggaaacgttgacccg
aatgctgtgggtaattgtaaccgaacaactggagaatgtttaaagtgtattcacaatact
gcgggtctacactgtgaccaatgcttgcccggtcattttggagatccatttgcactgcct
catggaaactgtgaagaatgtagttgttatccgcgaggaactgagcaaactgataaaggc
atttcaatctgcgaccccaacaatggtaactgtcagtgtaaaccaaatgtgattggacga
aattgcaacgaatgtaaaaatggttactggaatattatctctggaaatggatgtgaaaat
tgcaattgtgatccaactggaagctacaactcatcatgtgatacatatacaggagaatgt
tattgtaaaccaggcattattggcaaaaagtgtgatcagtgtgctttggcacactatgga
ttttcatcagaaggatgtaaatcttgtgactgcgatccgagtggttctaaaggttcacaa
tgcgatcaattcggacaatgtccatgcaacgataacgtcgaaggaagacgttgtgaccgt
tgtaaagaaaacaagtttgatcgtcatcaaggctgtctggattgtcctgcttgttataat
ctcgttcaggaagcagcaaatgaacatcgaggaaaattggcaaacttgaacaaaatattg
caagatattcagtctaaaccgatcgttatcgacgacaatgaatttgtctcgaaattacga
acagtacaagacaaaattgatatcttggttgaagacgccaaaagtggatccggtggagga
gaaaaaacattgaatgaaatgttacaggatttagaaaaaagactagaaattgtgcgtgac
ttactcagcaaagctgatgagtctcaagagtccacggaagtaaaaaatagtagaggagca
aacaacgcaacaattgctaacaatcaaatacaggatgctcgccgcgaattagaagcagcc
attgatttgttacagactgacggagcagctgcgttgagtaaagcacgagacatttctggg
catttaggaaatcaaacaaatcaaattagcggcatatctagggaagcacgacaatatgct
gaccaattcaaaaaagaagccgaagagaacaaaaaacaagctgaagaagcacacaaaaaa
gcgagtgaagctcatttattggccaaaactacaattaacttgcaggcacaaattggagaa
gaattcagaacaaatatttcaaatgaagttcaacaagccaaagaaaaattaaacacggta
tcgaaactgaccgaccaagctttaacaaaggcaaatgaagtatatgacgagtcattatct
ttatttgttgctgttaatagcgtttccccgccaagcatcaatatcgatcacattaaaaag
gaatcgaacaagtataacaaagaagcagacaaaataaatgcagatttggaaaaaacaatt
gaagatcatcaagctttgctcacggatgtaagtgaaaacatcgaacttgccaacacactt
ttagaaagggccgagtctcaaaagtttgacgccataaatgctgttaaggagttggaagat
gctaaagaactggcagttaaagcagttgccgaaggcgatggaacattgaaaaaagctaat
ttcacttaccatactctgtctgggttcaaaaatcaagtagacgaatctaaacaaaaagca
gcagatgcgttagaatcggtacctagcataaaacggcaaatcgataatgccattgagctt
attgctaattctgaagcggctttgagaagcgcaaaccataatgcgcttgaagcacgtaat
aatgctcagtcagcacaaaagaagtatgctgaggaagcttctaagcttgcggatagtata
aaaaaaagagcaaatactaccaaaaatacagctcgcgatttaaggcatgaagctgatcag
ttgaatggtcgattagccaaaacggaaaacagtcttgcagaacgagagacaaatattcga
aaagattttaacttaacgaaagaagctaaggaaaaagttggccaagctcaattgaattca
aacgaggccaaatctcaagtagaaaaggctatgaaagaagtaaaagctattatagatgaa
ctagctgatttgagagacatcgacatcaaaagtttgaatgctttagatgatcgtctgaca
gccgcagaaaaagaattagaagatgccaaactaactcataagttacacgtgttaaatgaa
tccaaaaatctacaaactcaaaatattaaaagctatcaacgggagatagcagaattggaa
aatgaggtagcaaacataaaaatgatttctgattctttaccagaaaattgctataaaaga
acacgtcttgagccataa

DBGET integrated database retrieval system