KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002118
Entry
CpipJ_CPIJ002118  CDS       T01079                                 
Name
(GenBank) iron-responsive element-binding protein 1
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00020  Citrate cycle (TCA cycle)
cqu00630  Glyoxylate and dicarboxylate metabolism
cqu01100  Metabolic pathways
cqu01200  Carbon metabolism
cqu01210  2-Oxocarboxylic acid metabolism
cqu01230  Biosynthesis of amino acids
Module
cqu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cqu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CpipJ_CPIJ002118
   00630 Glyoxylate and dicarboxylate metabolism
    CpipJ_CPIJ002118
Enzymes [BR:cqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     CpipJ_CPIJ002118
SSDB
Motif
Pfam: Aconitase Aconitase_C
Other DBs
NCBI-ProteinID: EDS32249
VectorBase: CPIJ002118
UniProt: B0W3V2
AA seq 901 aa
MAGPNPFQNLQKELTVNGECFRYFDISSFEELAELPYSIRVLLESAVRNCDNFQVLEKDV
RGILSWKSTKSIKTDVELEIPFKPARVILQDFTGVPAVVDFAAMRDAVLKLGGDPDKINP
ICPSDLVIDHSVQVDFARTPDALNKNQDLEFERNKERFTFLKWGAKAFNNMLIIPPGSGI
VHQVNLEYLARVVFQDDTKSKDGSKILYPDSVVGTDSHTTMINGLGVVGWGVGGIEAEAV
MLGQAISMLLPEVIGYKLVGKLNPLVTSTDLVLTITKNLRQIGVVGKFVEFFGPGVSELS
IADRATISNMCPEYGATVGYFPIDQNALDYLRQTNRAEDKVQVIEAYLKATNQLRNFSDA
SQDPVYTQVIELDLGTVVTSVSGPKRPHDRVSVSDMQKDFQECLTNKVGFKGFAIPDAQL
KTEGSFSWTDGNTYSLRHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVALGLKVAPYIK
TSLSPGSGVVTYYLKESGVVPALEELGFHVVGYGCMTCIGNSGPLDDNIANTIEKNNLVC
CGVLSGNRNFEGRIHPNTRANYLASPLLVIAYALAGTVDIDFEKEPIGTTPEGNNVFLRD
IWPTRAEIQEVERQHVIPAMFRDVYAKVELGASSWQSLNAPTGKLYPWDNASTYIKHPPF
FETMTRDLPKIGNIVGARALLNLGDSVTTDHISPAGSIARNSPAARYLSERGLTPREYNS
YGSRRGNDAVMARGTFANIRLVNKLVSGAGPRTLHIPSGEEMDVFDCAERYAQEGTALIA
IVGKDYGSGSSRDWAAKGPYLLGIKAVIAESYERIHRSNLVGMGIVPLQYLEGQNAETVG
LTGKELFNIVLPDNLKPHDKITVETDSGLQFQVIVRFDTEVDLEYFRNGGILNYMIRKMI
A
NT seq 2706 nt   +upstreamnt  +downstreamnt
atggctggtcccaaccccttccagaacctgcaaaaggagctcaccgtcaatggagaatgt
ttccgttatttcgatatttcatcgttcgaggagctcgctgagctgccgtacagcatccgt
gtgctgctggagtcggcggttcggaactgcgacaactttcaggtgcttgagaaggatgtc
cgaggcatcctgagctggaaatcgaccaagagcatcaagactgacgtagagttggaaatt
ccattcaagccagcgcgtgtgatcctccaggactttaccggtgttccggcggtggtggac
tttgctgccatgcgtgatgcagtgctcaagctgggcggagacccggacaagatcaatcct
atctgtccatcggatctggtaattgaccactcggttcaagtggactttgcacgtacgccc
gatgcgctgaacaagaaccaagacttggagtttgagcgcaacaaggaacgattcacgttt
ctgaagtggggagccaaggctttcaacaacatgttgatcatccctcccggatccggtatc
gtccatcaggttaatctggagtacttggcacgtgtcgtttttcaagatgataccaagtca
aaggatggaagcaagattctctacccagatagtgtggttggaactgattcccacactacc
atgatcaacgggttgggagtggttggctggggtgtcggaggaatcgaagcggaagctgtt
atgctgggacaagcaatctccatgttacttcctgaggttatcggatacaagctagttggc
aagcttaaccctctggttacgtcaacggatttggtgttgaccatcaccaagaatctgcgc
cagattggagtcgtcggaaagtttgttgaattcttcggacctggtgtcagcgagttatcg
atcgcagatcgtgctacgatcagtaacatgtgtcctgagtatggtgcaaccgtgggatat
ttcccgatcgaccagaacgcgttggattatctccgacagacgaaccgtgccgaagataag
gtccaggtcatcgaagcgtatttgaaggccaccaaccagttacgaaactttagcgatgca
tcccaagatccggtatacactcaggtcattgaactggatttgggcactgtcgtgacgtcc
gtttccggcccaaaacgtccccatgaccgtgtttctgtaagcgatatgcagaaggacttc
caggagtgtctcacaaacaaagtcggcttcaagggattcgctattccggatgcccaactc
aaaaccgaaggtagttttagctggaccgacggaaatacctactcccttcgacatgggtcg
gtggtcattgctgcgattacatcttgcacaaacacgagcaatccttccgtaatgttggga
gctggtttgctggccaagaaagccgttgctcttggactgaaggttgcaccgtatatcaag
acttccctgtcccctggaagcggagttgtcacctattatctgaaggaatctggtgtggtc
ccagcactggaagaactcggattccacgtcgttggctacggttgcatgacctgcatcggc
aactctggtccgctggacgataacattgctaacaccatcgagaagaacaatctggtttgc
tgcggagtactttctggaaaccgtaacttcgagggtcgtattcatccgaatactcgtgcc
aactatctggcaagtccgctgctggttattgcgtacgctttggccggtacggttgatatc
gatttcgaaaaggaacccatcggtacgactccggaaggaaacaacgtatttctgcgtgac
atctggccaacccgtgccgaaattcaggaagttgaaagacagcatgtcatcccagccatg
ttccgtgatgtttacgccaaggttgagcttggtgcgtcatcatggcagagcctgaatgcc
ccaacgggaaaattatacccatgggacaatgcctccacctacatcaagcacccaccattc
ttcgaaacgatgacccgcgatttgcccaagatcggaaatattgtcggagcccgtgctttg
ctcaacttgggtgattcggtaacaactgatcacatttctccggctggttccattgctcga
aacagcccggcggcacgttatctatccgaacgtggacttactccacgagaatacaactct
tacggatctcgccgaggtaatgacgcagtgatggctcgcggtacctttgcaaacatccgc
ttggtgaacaaattggtttccggtgctggtcctcgtacgcttcacattcccagcggagaa
gagatggacgtgttcgactgtgccgagcgttatgcacaggagggcactgcgttgattgcg
attgttggcaaggactacggaagcggatctagtcgcgattgggcagccaagggcccgtac
ttgctgggaatcaaggccgttattgccgagtcgtacgagcgtattcaccgctcgaacttg
gtcggaatgggaatcgtcccgctgcaatatttggagggacaaaacgccgagactgttgga
ttgaccggaaaggaactgtttaacattgtgttgccggacaatttgaagccacacgataag
atcacggttgaaaccgacagcggactgcagttccaggttattgttcgttttgatacggag
gtcgatttggagtacttccggaacgggggaattttgaactacatgatcaggaagatgatt
gcctaa

DBGET integrated database retrieval system