KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002544
Entry
CpipJ_CPIJ002544  CDS       T01079                                 
Name
(GenBank) transcription initiation factor TFIID subunit 6
  KO
K03131  transcription initiation factor TFIID subunit 6
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ002544
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ002544
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ002544
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     CpipJ_CPIJ002544
   Coactivators
    SAGA/TFTC/STAGA complex
     CpipJ_CPIJ002544
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     CpipJ_CPIJ002544
    STAGA complex
     CpipJ_CPIJ002544
    TFTC complex
     CpipJ_CPIJ002544
    SAGA complex
     CpipJ_CPIJ002544
    SLIK complex
     CpipJ_CPIJ002544
SSDB
Motif
Pfam: TAF6_C TAF
Other DBs
NCBI-ProteinID: EDS36426
VectorBase: CPIJ002544
UniProt: B0W679
AA seq 614 aa
MSDGDKTMYGTTLSLESIKVIAESIGVGSLPDDAAKELADDVSIKLKQIVQDAAKFMHHS
KRMKMSIADIDHSLKVRNIEPQYGFVSPDFIPFRFASGGGRELHFIEEKEIDLAEVIQTA
PPKIPLDITLRAHWLCVDGVQPTIPENPPPLSKDVQALDSVNPVNKLDKAHIKDTTGKPA
IGKAHKLKNVETVHVKQLATHELSVEQQLYYKEITEACVGSDEARRAEALTSLACDPGLH
EMLPRMCTFIAEGVKVNVVQNNLALLIYLMRMVRALLDNPALYLEKYLHELIPSVSTCIV
SRQLCMRPELDNHWALRDFAARLMAQICKNFNTSTNNLQTRVTRLFSAALQNDKTPLSSL
YGALEGLSELGTEVIKVFIIPRLRFISDRVEVHLQGSNISAVDKIAAGHIRAMLQKVCSP
VLKTLRNPPDVVEEYKKDYGFLGPTIHQGVIKARTAPPTAPTCTSSSSVSVNNVSIVTTA
ATTPARPQTPLISSVVNKPSGSGAIQRQSSSQGGSSASGQQKFVIVSQRQQTPSPSQDDF
VGIIQQSQRSSVGGSSQQGLIKIEPQSGAAAVAAQKLVVINQSTPQQGPAANVITIGGTQ
TGPPPELDDLSHLA
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgagcgacggcgacaaaaccatgtacggcacaacgctgtcgctggagtcgatcaaggta
atcgcggaaagcatcggcgtcggcagcttgccggatgatgccgccaaggagctggcagac
gatgtgtccatcaagctaaagcaaattgtgcaggatgcggccaagtttatgcaccactcg
aagcggatgaagatgtcgatagccgacattgaccactcgctgaaggtgcggaacattgag
ccgcagtacgggttcgtttcgccggattttattccgttccggttcgcttccggtggtggg
cgggagttgcactttattgaggagaaggagattgacctggcggaggtaattcagacggcg
ccaccgaagattccgctggatattacgctgagggcccattggctgtgtgtggacggagtg
cagccgacgattccggagaatccgccgccgctgtcgaaggatgttcaggcgttggactcg
gtgaatccggtgaataagctggacaaggcgcacattaaggacacgacgggaaagcccgcg
atagggaaggctcacaagctgaagaacgtggaaacggtccacgtgaagcagctggccacg
cacgaactatccgtggagcagcagctgtactacaaggagattaccgaggcgtgcgtcgga
tcggacgaagctagaagggccgaagcgcttacctcgctggcgtgcgatccaggactgcat
gagatgctgccgaggatgtgcaccttcattgccgagggcgtgaaggtcaacgtggtccag
aacaatctggcgctgctgatttatctgatgcgcatggtgcgagccctgctggacaatccg
gccctgtatctggagaaatatcttcacgaactgatcccgtccgtctcgacctgcatcgtt
tcgcggcagctgtgcatgcgccccgaactggacaaccactgggcgctgcgcgactttgcc
gcccggctgatggcccaaatttgcaaaaactttaacacttccactaacaatctgcagacg
cgcgtgacgcgactcttcagcgcggccctgcaaaacgataaaactcccctttcgtcgctg
tacggcgccctcgagggactctcggagctgggcacggaagtgatcaaggtgtttatcatc
cctcggttgcgcttcatttcggaccgggtcgaggtgcacctgcagggaagcaacatcagt
gcggtggacaagattgcggccggtcacatccgggccatgctgcaaaaggtttgctcgccg
gtgctgaaaacgctccgcaatcccccggacgtcgtcgaggaatacaagaaagattacggc
ttcctcggtccaaccatccaccagggtgtgatcaaggcacggacggcacctccgacggcc
ccaacctgtaccagcagcagcagcgtgtccgtgaacaacgtttcgatcgtgaccactgcg
gccaccactcccgcacggccacagactccgctgataagctcggttgtcaacaaaccgtcc
ggttccggagccatccagcggcagtcatcgtcccagggtggttcctctgccagtggacag
caaaagttcgtcattgtttcccaacgccagcagacgccgtcgccgtcgcaggacgacttt
gtcgggatcatccagcaaagtcagcgctccagcgtgggtggatcctcccagcagggactc
atcaagatcgagccccagtcgggtgccgccgccgtcgccgcccagaagctggtcgtaatc
aaccagtcgacgccgcagcagggtccggcggcgaatgtcatcaccatcgggggcacccag
acggggccgccgcccgagttggacgatttgtcgcatctggcttaa

DBGET integrated database retrieval system