KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002848
Entry
CpipJ_CPIJ002848  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K13506  glycerol-3-phosphate O-acyltransferase 3/4 [EC:2.3.1.15]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00561  Glycerolipid metabolism
cqu00564  Glycerophospholipid metabolism
cqu01100  Metabolic pathways
Module
cqu_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CpipJ_CPIJ002848
   00564 Glycerophospholipid metabolism
    CpipJ_CPIJ002848
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cqu01004]
    CpipJ_CPIJ002848
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     CpipJ_CPIJ002848
Lipid biosynthesis proteins [BR:cqu01004]
 Phospholipid acyltransferase
  GPAT
   CpipJ_CPIJ002848
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-ProteinID: EDS36876
VectorBase: CPIJ002848
UniProt: B0W6P5
AA seq 572 aa
MEVLASVSSVLSMFALTPVISLMFFIIFLASIGKSLGVRRMYVSLLVKIFEYGRQNIESI
RKQQFANLDTSDTDDGSTQAGKETADAGSEGDKPDCASKLNGNANKHLSNGDLANGGNSV
ISRVESLILLPDVDGTRSKSRESNHEDGQNDSLEFKLSNCLDYVKSGMEAIIEDEVTSRF
EAEELKNWNLLTRTNRHYEFISLKLTIIWVFGFFIRYVILMPSRVFICFVGVVYCVIGFA
IVGIIPQRKLRVRANDYVFKRTFRIICRSLSAVIRFHNAQFKPKNCGFCVANHTTPIDIA
ILSTDHSYSLVMWLTLCTALVGCIPEGPTKRWMVKMVLIQCFGVLSSALSSVVNYHNLEN
RPLNGICVANHTSPIDVLMLMCDNCYSLIGQRHGGFLGVLQRALARASPHIWFERAEAKD
RMAVAKRLKEHVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVGGVIYPVAIKYDARFG
DAFWNSSRYSMMQYLYMMMTSWAIVCDVWYLPPMTRGEDESAIDFANRVKGVIAKQGGLV
DLVWDGQLKRMKPKKEWMEKQQEEFTKRLKGE
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggaggttctggcttcggtcagctcggttctatcgatgttcgcgttaactcccgtcatc
agccttatgttcttcattatatttctggcctcgattgggaaatccttgggtgtgcgccgg
atgtacgtgagcctactggtgaagatttttgagtatggccgtcaaaatatcgagtccatc
cggaagcaacagtttgccaacctggacacatcggacacggatgacggcagcacccaagct
ggcaaagaaaccgccgatgctggttccgagggcgacaaaccggactgcgccagcaaactc
aacggtaacgccaacaagcatctctcgaacggtgatctcgccaacggaggcaactcggtc
ataagtcgtgttgagtcgcttattctgctgccggacgtcgacggcacccggagcaagagc
cgcgaatcgaaccacgaggacgggcaaaatgactctttagagtttaaattatcaaactgt
ttggattacgttaaatccggaatggaagcaatcatcgaagatgaagtgacaagtagattc
gaggcagaagagctgaagaattggaatctgctcactcgcacgaaccggcattatgaattt
atatcgttgaagctaaccattatctgggtgtttgggttcttcattcgatatgttattcta
atgccaagtagagtatttatctgtttcgttggggtcgtctattgcgtgataggatttgcc
attgtcggcataataccccagcggaagctgcgagtgcgcgcgaatgattatgtgttcaaa
cgtacgttccgcataatctgccgctccttgtccgcggtgattagattccacaacgcacag
ttcaagccaaaaaattgtggcttttgcgtcgcgaatcatacgactccaattgatattgca
attctttcaacagaccactcctactctttggtcatgtggttgacattatgcacggcactg
gtcggttgcataccggaaggacccaccaaacgatggatggtgaagatggttttgatacag
tgcttcggtgtactctcgagtgccctgtcgtccgttgtcaattatcataacttagagaat
cgcccattaaacggcatctgcgtggcgaaccacacaagtcccatcgatgtgttaatgtta
atgtgtgataactgttattcgttgattgggcaaagacacggcggctttttaggagtattg
cagcgagctctggcacgggcttcgccacacatctggttcgagcgtgcggaagcaaaagac
agaatggcagttgctaaaagactgaaagagcacgtgtcggatcctaacaatccaccgatt
ctgattttccccgagggtacttgcatcaacaacacttctgtaatgcaattcaaaaaagga
agtttcgaagttggaggtgtgatctacccagttgcgataaaatacgatgcacggttcgga
gacgcgttctggaacagctcgcgatattcgatgatgcagtatttatacatgatgatgaca
tcgtgggcaatagtatgtgatgtctggtatcttcctccgatgacgcgcggcgaggacgaa
tccgcgatcgactttgccaaccgggtgaagggcgtaatcgcgaaacagggcggtctggtc
gacctggtgtgggacggccagctgaagcgcatgaagccaaagaaggaatggatggagaag
cagcaggaagagtttaccaaacgactcaagggagaatga

DBGET integrated database retrieval system