KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002929Help
Entry
CpipJ_CPIJ002929  CDS       T01079                                 

Definition
(RefSeq) ADRM1
  KO
K06691  26S proteasome regulatory subunit N13
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03050  Proteasome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    CpipJ_CPIJ002929
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:cqu03051]
    CpipJ_CPIJ002929
Proteasome [BR:cqu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     CpipJ_CPIJ002929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPN13_C Proteasom_Rpn13 ASXH
Motif
Other DBs
NCBI-GeneID: 6034192
NCBI-ProteinID: XP_001844547
VectorBase: CPIJ002929
UniProt: B0W763
AA seq 441 aa AA seqDB search
MSGPIFGSSSALGGSSGGNRHLVEFRAGRMNLVNKMVHPDNRKGLVYVYQAEDGLIHFCW
KDRTTGNVEDDLIVFPDDCEFKKIDNVKTGRVFLLKFKSSSRRLFFWMQEPKTDKDEEWC
RRINEVINNPPSSNSLGGGSGRGGSGSDNGDLQYIMQNMSQQQLMQLFGGVGQMGGLSSL
LGSMSSRSSSGNSSSRTGATTPSSRSTLSSSNAGSGTAVTTPTTATAGSPSTPRAPRKNA
SESSKSSNAGAAVTATPIGAGTGGGEGGNRVRLADLQNYLAGMSPAAAAGSGGQRRNVDL
ASAVTSDSLSSVIANQEMVDALVEHLPEVEGDDNKKQQLKETLSSPQFQQALSMFSNALQ
SGQLGPVVSQFQLNAEAVAAANSGDLEQFVKALENAHKSDAGADKKATTPTADKPAESTT
AAQEENGKSAEKKTEDDEMAG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaccaattttcggcagcagcagtgccctcgggggcagttccggcgggaatcgc
cacctggtggagttccgggctgggcggatgaatctggtgaacaagatggtccacccggac
aaccggaaggggctggtgtacgtgtaccaggcggaagatgggttgattcacttttgctgg
aaggatcgtacgactgggaacgtggaggacgatttgattgtgttcccggacgattgcgag
ttcaagaagatcgacaacgtcaagacgggccgggtgtttttgctcaagtttaagagctcg
agccggcggttgttcttctggatgcaggagcccaagacggacaaggatgaggagtggtgc
cgccggattaacgaggtcatcaacaatccgccctcgtcgaacagtttgggcgggggttcg
ggccggggtggcagtggaagcgacaacggcgacttgcagtacatcatgcagaacatgtcc
cagcagcagctgatgcagctgtttggcggcgtgggtcagatgggtggactgagcagtctg
ctggggtcgatgagcagccgctcatcttccggcaattcgagcagccgcaccggcgccacc
actccgtccagccggagcacattgtcgtcgagtaacgcgggcagcggcacggccgtcaca
acgcccacgaccgccaccgccggatcgccgtcgacgccgcgtgccccccgcaagaatgct
tccgaatcgtccaagagcagtaatgctggcgctgcggtcacggccacgcccattggagct
ggcaccggcggcggtgagggtggaaaccgcgtccgattggccgacctgcagaactacctg
gccggtatgagccccgcagcggcagctggctccggaggtcagcgacgcaacgttgacctg
gcctcggccgttacctcggactcgctgtcttcggtgattgccaaccaggaaatggtggac
gcgctcgtagaacatcttcccgaggtcgaaggcgacgacaacaagaagcagcagctgaag
gaaaccctgtcctcgccccagttccagcaagccctgtccatgttctccaacgcgctgcag
tccggccagcttggaccggtggtgtcgcagttccagctgaacgccgaagccgtcgccgcg
gccaacagtggcgacctggaacagtttgtgaaagccctcgaaaatgcccacaagagcgat
gccggcgccgacaagaaggcgaccactcccacggcagacaaaccagcggaatccacgacg
gcagcccaagaggaaaatggcaaatccgccgaaaagaagaccgaagacgatgaaatggcc
ggatag

DBGET integrated database retrieval system