KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003154
Entry
CpipJ_CPIJ003154  CDS       T01079                                 
Name
(GenBank) c-AMP specific 3',5'-cyclic phosphodiesterase
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00230  Purine metabolism
cqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CpipJ_CPIJ003154
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     CpipJ_CPIJ003154
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-ProteinID: EDS38202
VectorBase: CPIJ003154
UniProt: B0W7Q8
AA seq 722 aa
MIVAVFVLFSLFRGLTHKRKSSSAAKSPTPSAAVVQVSGTGPLDRLQHHKNNGSVEGTNL
NSSIEDLCVSLCQSESIYSSATSKIYDKRRQDSSSICSDIFNTDEGGGGGRSSVSEETRF
TARKSLTRIRRCTSRTSLSRRRRTTGSFDVENGQGSRSPLEGGSPAAAAAAGLVLQNLPQ
RRESFLYRSDSDFEMSPKSMSRNSSIASERSKRNNVQVTPIPKAHTPGDESYVKLALDTV
DELDWCLDQLETVQTHRSVSDMASLKFKRMLNKELSHLSESSKSGNQISEYICSTFLDKQ
QEVDIPYSRDDTDVLNPASLNRSRSPRSMGERMSQISGFKRPLMHTNSFTSDRLPMYGVD
TPHESQLGQVLNIVDTWGIDIFKIETLSNNRPLTCVAFAIFQDRDILNTLMIPSKVFLAF
MTTLEDHYVKDNPFHNSLHAADVAQSTHVLLNTPALENVFTPLEICAALFAACIHDVDHP
GLTNQFLINSSSELAIMYNDESVLENHHLAVAFKLLQNEECDILRNVQKKQRQTFRKMVI
DMVLSTDMSKHMTLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKP
LPLYKKWVSLLMEEFFQQGDKERAAGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWG
DLVHPDAQDILDTLEENRDYYQSLIPPSPPALDDPEEKIRFQMTLEEESASENDESNREE
KS
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgattgttgctgtatttgtactattttcactgttccgcggactcacgcacaagagaaaa
tccagttccgctgccaaaagccccacaccgagtgctgcggtagttcaagtgtccggaacc
ggaccattggaccggctccaacaccacaagaataacggttccgttgagggcactaatttg
aactcgtccattgaggacctgtgcgtttcactttgtcaaagtgagtcaatttattcgtcc
gcgaccagcaaaatctacgacaaacgtcgccaggactcgtcctcgatatgttcggacatt
ttcaacacggacgagggagggggtgggggcaggtcgtcagtgtcggaggagacgagattc
accgcccgcaagagcttgacccgaattcgacggtgcacgtccagaacgagtctgagccgg
agaagacgcacgaccggaagcttcgatgtcgaaaatggccaaggttcacgttcaccgctg
gaaggtggatcaccagcagccgccgctgccgccggtttggtactgcagaatctacctcaa
cgaagggaatctttcctgtatcggtccgattcggatttcgagatgtcgccgaagtcgatg
tctcgaaactccagcatcgccagcgaaagatcaaaacgaaacaatgttcaagtgacgcca
atcccgaaggcgcacactcccggggacgagtcgtatgtgaagctggctttggatacggtc
gacgagctggattggtgtctggatcagctcgagacggtgcagacgcatcgcagtgtttcc
gacatggcatccctgaagttcaaacggatgctcaacaaagaattgtcacatcttagcgaa
tcaagcaaatctggcaaccaaatctccgagtatatttgttcaacgtttttagacaaacag
caagaggtggacataccgtacagcagagacgataccgacgtgctaaaccctgcctctctc
aaccggagccggtcgccgcgcagcatgggcgagcggatgtcgcagatatcgggcttcaag
cggcctctgatgcacaccaactctttcaccagcgatcgtttgccaatgtacggcgtggac
acgccccacgagagccaactgggacaggttctcaacattgtggacacgtggggcatcgat
atcttcaaaatcgaaactctaagcaacaatcgaccgctgacctgtgtagcttttgctatc
tttcaggacagggacatcttgaacactcttatgataccatccaaagtttttctagcgttt
atgacaaccttagaggatcattatgttaaggacaacccatttcacaactctctgcacgcg
gcggatgtggcccagagcacgcacgttctgctgaacacgccggccctggagaacgttttt
actccgctagagatctgcgcagcgctgtttgctgcttgtatccacgatgttgatcatcct
ggtttaaccaatcagtttttaattaattcgagttcagaactagcaattatgtacaatgac
gaatccgtactagaaaatcatcatttagcagttgcatttaaactcttacaaaatgaggag
tgcgacatactacgcaatgtacagaaaaagcagcgtcaaacatttcgaaagatggttatt
gatatggtgctatcaacggacatgtcaaagcatatgaccctactggctgatctgaaaacg
atggtcgaaactaaaaaagtcgccggctctggagtgctgctgctggataactacaccgat
aggatacaggttttggagaacttggtacactgcgccgatctgagcaatcccaccaaaccg
ttaccgttgtacaaaaaatgggtctcactgctgatggaggagtttttccagcagggcgac
aaggagcgggcagccggcatggacatcagtccgatgtgcgaccgccacaatgcgacaatc
gagaaatcgcaggtcggctttatcgattacattgtgcacccgctgtgggaaacctgggga
gatctggtgcatccggacgcccaggacatcctggacacgctggaggagaaccgcgactac
taccagagcttaataccgccgtcaccgcccgcgctcgacgaccccgaggaaaagattcgc
ttccagatgacgttagaggaggaaagcgcttcggagaacgacgagtcgaatcgcgaagag
aaatcctaa

DBGET integrated database retrieval system