KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003218Help
Entry
CpipJ_CPIJ003218  CDS       T01079                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 22
  KO
K11366  ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CpipJ_CPIJ003218
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CpipJ_CPIJ003218
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CpipJ_CPIJ003218
Ubiquitin system [BR:cqu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    CpipJ_CPIJ003218
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     CpipJ_CPIJ003218
    SLIK complex
     CpipJ_CPIJ003218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 zf-UBP Peptidase_C98 CCDC53 CAP_N CDK2AP
Motif
Other DBs
NCBI-GeneID: 6034243
NCBI-ProteinID: XP_001844589
VectorBase: CPIJ003218
UniProt: B0W7A5
AA seq 546 aa AA seqDB search
MSDHGCAHFGAFVKEYGLEPFSVVHAYFSVCINKEARRRKALSCLCFKCGGSGPQLYSCL
HCIYFGCKGAHIGEHCKQTKHYIVLELSYGMIYCHQCKDFIYDAECQAIAEKHIKKEAKS
LNKSLSWRPWSPSKLEIDLLLKNPKRRHVTAVTSIGLRGLLNLGSTCFMNCIVQALIHTP
LLRDYFLSERHECTAKTAAKCLVCEVSRLFQEFYSGARGPLSLHRLLHLIWNHARHLAGY
EQQDAHEFFIATLDVLHRHCKISMTEMAAAAAAAAEKSNKPHQPPPPPPHQDSNPTQCNC
IIDQIFTGGLQSDVVCQACNGVSTTIDPFWDISLDLGEAQNQGYGGPPKSLIDCLERFTR
AEHLGSSAKIKCSTCKSYQESTKQLSMRTLPIVASFHLKRFEHSSLIDKKISTFISFPAE
LDMTPFMSKKKSDQSNPSTSSTSSSSHSSKSKSSDRKQQHQQAQQSNDEATAAAATDASG
DFRYSLYAVINHVGTLDAGHYTAYVRHQKDIWVKCDDHIITTATLKQVLDSEGYLLFYHK
KVLEYE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccacggatgtgcccacttcggggcgttcgtgaaggagtacgggctggagccg
ttcagcgtggtgcacgcgtactttagcgtgtgcatcaacaaggaggcccgccggcggaag
gccctgtcctgtttgtgcttcaagtgtggcggttccgggccgcagctgtactcgtgtctg
cactgtatctactttggctgcaagggggcgcacatcggggagcactgcaagcaaacaaag
cactacatcgtgctggaactgagctacggaatgatttactgccaccagtgtaaggacttt
atctacgacgccgagtgccaggccatcgccgagaagcacatcaagaaggaagcgaaaagt
ctcaacaagagtctctcgtggcggccctggtcgccgtccaagctggagattgacttgctc
ctgaagaacccgaagcgacggcacgtgacggccgtgaccagcatcggccttcgtgggctg
ctcaacctcggctcgacctgcttcatgaactgcatcgtccaagcgttgatccacacgccc
ctgctgcgggactatttcctatccgaacggcacgagtgcaccgccaagaccgctgccaaa
tgtctcgtctgtgaagtgtcccgtctcttccaggagttttactccggcgcccgtggccca
ctctccctgcaccgtctgctgcatttaatctggaaccacgcgcgacacctcgccggctac
gaacagcaggacgcgcacgagtttttcatcgccacgctggacgtgctccaccggcactgc
aaaatctcgatgaccgaaatggcagcggccgccgccgcagccgcagaaaagtcgaacaaa
cctcaccaaccacctccgccaccaccccaccaggacagcaacccgacccagtgcaactgc
atcatcgaccagatcttcaccggtggcctccaaagtgacgtggtctgtcaggcctgcaac
ggcgtctccaccaccatcgatcccttctgggacatttcgctcgaccttggggaggcccag
aaccagggctacggagggccgcccaagtcgctcatcgactgcctcgagcggttcacgcgg
gccgaacatctcggctcgagcgccaaaatcaaatgttccacctgcaagagctaccaggaa
tcgacgaagcagctgtcgatgcgcaccctgccgatcgtggccagcttccacctgaagcgg
ttcgaacactctagtctgattgacaagaagatctccaccttcatctcattcccggccgag
ctggacatgactccgttcatgtcgaaaaagaagtctgaccagtccaacccttccacctcc
tccacctcttcctcatcccactcttcaaagtctaaatcctccgaccggaagcagcaacat
cagcaggcgcaacaatccaacgacgaagccacggcggcggcggcgacggacgcatccgga
gactttcggtactcgctgtacgccgtcatcaaccacgtggggacgctggacgcgggccac
tacacggcgtacgtgcgccaccagaaggacatttgggtcaagtgcgacgaccacatcatt
acgactgccacgctcaagcaggtgctggatagtgagggctatctactgttttaccacaaa
aaggttctggagtatgagtag

DBGET integrated database retrieval system