KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003365Help
Entry
CpipJ_CPIJ003365  CDS       T01079                                 

Definition
(RefSeq) phopsphatidylinositol 3-kinase
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00562  Inositol phosphate metabolism
cqu01100  Metabolic pathways
cqu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CpipJ_CPIJ003365
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CpipJ_CPIJ003365
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     CpipJ_CPIJ003365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka C2 PX PI3K_C2 PI3K_rbd DUF4135 Polyhedrin
Motif
Other DBs
NCBI-GeneID: 6034505
NCBI-ProteinID: XP_001844810
VectorBase: CPIJ003365
UniProt: B0W7X6
AA seq 1917 aa AA seqDB search
MSSRHEVEMEKQFLADLEKAKALSLETHELEKIRKQRYSQPDPSIYSETNNLEEYKQYLQ
RKAQLHQAKTGATAISVAPPSSARRNSDTRNPLTNATPTSSIDQQRGRDEADLMSFNPPP
PVPNPQDEAHNSLKELVDKMHRMNTQQQYEHPVYKTQRSYSVASAPTYGGYTPAYLQQQI
VPNYSPASMQLVPYQQTPSDKPSKLTPDELARLYSMPTAYGVTPQPGFIPQGQYQPNAYL
PHPQFPVQYAPAPTTAYIPQSQPVAATVAPPAPGFIVQPSPPPAVATIANPETALVHVPK
PVAPLSKLTLANRSTSQPVQPFPPAIPGPSSSSTSNPFARNSLGAPGASSAATTAKSNGE
QVVLRPKSDPPAATARLGDNLIDLGPFEENSRVSVLEAFDPLLCGHRSSLSSGASEDDKD
DTASTYYEDYDPFDYIYSGGTQYSDPVYEAVSRSDRTPLSPNSSGSGPPPAPGWSVSSAY
GFGEPDLEMDPPPLPPRNSDLYHPMMGAVTAAAVGNEPSSSAGNYEVMQRKTIERRPAPT
KLYENVVIKKSYDRELIAFYEMVKHLREQYRCDDSGSNVGHVVASEFDNHYPEGTSIKLL
VHPALDCFTSYDSQNKGQIDGYGPPIPFTCDITTTVEHVIAYVFCALEGQVLNGVGDYIL
KAIGIQEILSPRSRLNQLQCVHNSIKLEHDVQLGFIAKTPRIMQSIARTAQDDKRDSELR
LEHILPREATSAISYDDLMILLECLEAEIEKLQSTADDHSPHTILSCSGVIQAVKAICNM
LGPIDTLDITKSIDDLKTCCDSCQTIYSYGDSSDYNNGSLSIVSESGDYAEVTLRPRTVS
QQIRYRCNEVRNAIQGLLEIYSHAFRVNFCVNVPEWDTNPVSICNISQSVMVNVMCLHRP
PMHWKHDEYNLGVQIYHGARFISEAVVTQCPNEITGIYPRLKFNSWIMFRNPVCTLPREA
RLIFVLYGVTREPVEGDKQQEGGATSSDGPTQEGRVTKVELGWASIQFFDFERKMIQGSY
LLSLWPPTAEKYFGPAPAKGTHPLGSSYPILGIEIPSYGGAVVFPEPIKNLPPWSKLDFN
SLDRNLQQELIDTAEQGYSADKLEKREVLWEKRHYLHSLPHALPKILHAAHSWDYACLAD
LHALLKSWSAMTPVQALELLLPRYPDLEVRRQAVEWISHMPNDEFVDYLPQLLQALKHDT
YEASPLSRLLLQKSLESPRIAHHMYWLLLHSLPGEAPQNMVEMNQIDEALVNQARYHRRN
QLMLRALMATCGEKLTARFLSQNMMCKKLGEVAQSVKIAKESHRLQMLKQGLESVNQMLI
DAPTVLPLGPGNEVTGIVVRSCNYFNSNTLPLKVNFMGPDKVIVPAIFKSGDDLQQDMLT
IQMVRIMDKLWLREGLDLKMVTFNCVPTAYKKGMIEMVSDSETLRKIQVEWGLTGSFKDK
SIAEWLAKQNPSQLEYQRAVENFTRSCAGYSVATYILGICDRHNDNIMLKTSGHLFHIDF
GKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDRPSAKFHKFVDLCCTAFNIVRKHGDL
ILHMFALMTTSGIPGVTVEAVNYVRNALLPGQSNPEAAASFAKMIHISLKSWFTQFNFFL
HNIAQMKFSAESDDGELLSFVPRVYTMAQDGRLKSVTVHGFQKRYDLEKYYTYILKVTRQ
NQPDPAYLFRSYKEFCEFHQKLCIHFPLAKLHSLPSGIHVGRSNVKTVAERRLPEIRQFL
ISLFNAADEIAHSDLVYTFFHPLLRDQQEADIHAAKVKGNRAIMDEYQQPRGEIKFSLQY
HRDALIVMIQHARALPTTANNPEPNTYVKVYLRPDQAKATKRKTKVVRKNCNPSFMETLE
YRLPLDFIQKKTLEVTVWSHDSLQENAFLGGYRLALAELDLRHEINEWFPLSYLTRA
NT seq 5754 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccgacacgaggtcgagatggagaagcagttcttggccgatctagagaaggcc
aaagcgctcagcttggagacgcacgagctggagaagatccgaaagcagcgttactcccag
ccggatccctccatctattccgagacgaacaatctggaggagtacaaacagtaccttcaa
cgaaaagcacaattacatcaggccaaaacgggtgcgaccgcaatttccgttgctccaccc
agctctgcccgtcgcaacagtgatactcgcaatccgttgacaaacgccacccccaccagc
agcattgatcagcaacggggcagagatgaagctgatttgatgtccttcaaccctccgcca
ccggtgccgaacccgcaggacgaagcccacaatagtctaaaggaattggtcgacaagatg
catcgcatgaatacccagcaacagtacgaacatccggtgtacaaaacacaacgtagttac
agcgtagcgtcggcaccgacctacggcggatacacgccggcatatcttcagcaacagatt
gtcccaaactacagtccggcgtctatgcaactcgtcccgtatcaacagacaccgtcggat
aaaccatccaaactaacgccggacgagttggcacgtctctacagcatgccgacagcctac
ggggtcactccacagccaggtttcatccctcagggccaataccaacccaacgcatatctc
cctcatcctcagttcccggtccaatacgcaccagctccaacaaccgcttacattcctcaa
agccaaccggtagcagcaacagttgctccaccggcccccggcttcatcgttcaaccttcc
cctccccctgcggtggccacaattgccaacccagagaccgcactggtgcatgtccctaaa
cctgttgcccccctctcgaaactgaccctggccaatcgttccacctcccaaccggtgcaa
ccgttcccacccgccatccctggcccatcatcctcttcaacgtccaatcctttcgcaaga
aactcgctcggagcgcccggagcttcatcggcggccaccaccgccaaaagcaacggcgag
caggtcgtgctgcgtcccaaaagtgatcccccggcggcgacggcccggctcggcgataac
ctgatcgatctgggtccgttcgaggaaaattcacgagtgtcggtgctggaggcgttcgat
ccgttgctgtgcggtcaccggagcagcctcagcagcggtgccagcgaggacgataaagat
gatacggcttcgacgtactacgaggactacgatccgttcgattacatctacagcggtggc
acgcaatactcggatcccgtgtacgaagcggtcagccgctcggatcggacgcccctctcg
ccaaacagtagcggctcgggtccgccaccggctccgggctggagcgtctcgagtgcgtat
ggcttcggcgagccggacctggagatggatccaccgccgttgcctccgcgaaattcggac
ctttaccatccgatgatgggggcggtcactgcagccgcggtcgggaatgaaccttcgagc
tccgccggaaattacgaggtgatgcagcggaagacgatcgagcgacgtccggcgccgacg
aagctgtacgagaatgtggtcatcaagaagagctacgacagggagttgattgcgttctac
gagatggtgaagcacttgagggaacaataccgctgtgacgattcgggaagcaacgtgggt
cacgtggtcgcgtccgagtttgacaatcactaccccgagggaaccagtattaagctgctt
gtgcatccggcgctcgattgcttcacgtcgtacgacagccagaacaagggccagatcgat
ggctacggaccgccaatcccgttcacctgtgatataacgaccacggtggagcacgtaatc
gcgtacgtcttctgtgccctcgaaggccaggttctgaacggcgtcggcgattacatcctg
aaagcgatcggcatccaggagatcctgagtccacgatcgcgtctcaaccagctgcagtgc
gtgcacaacagcatcaagctggagcacgacgtccagctgggcttcattgcgaagacgcct
cggatcatgcagagcattgcgaggacggcgcaggacgacaagcgggactcggagctccgg
ttggagcacattttgccacgggaggctacttcggctattagctacgacgacttgatgatc
ttgctggagtgtctcgaggcggagattgagaagctgcagtcgacggcggacgatcacagt
ccgcacacgatcttgagttgttccggggtgattcaagcggtgaaggccatctgcaacatg
ctcgggccaatcgatacgctcgatatcaccaagtcgatcgacgaccttaagacgtgctgt
gacagctgccagacgatctacagctatggggattcgtcagattacaataatggaagtttg
agcatcgtttcggaaagtggagattatgccgaggtgacgcttcggccgcgtaccgtgagt
cagcagatccggtaccgctgtaacgaggttcggaacgcaatacagggactgctggagatt
tactcgcatgcattccgcgtgaacttttgcgtaaacgtgcccgagtgggacacgaatccg
gtgtcgatctgcaacatatcgcagagtgtgatggtcaacgtgatgtgtttgcacagacct
ccgatgcactggaagcacgacgagtacaacttgggcgtgcagatttatcacggagcgagg
ttcatcagtgaggcggtggtcacgcaatgtccgaatgaaattacagggatttatccgcgg
ttgaagttcaactcgtggatcatgttccggaatcctgtttgtactctgccgagggaggcg
aggttgatcttcgtgctttacggggttacacgggagcccgttgaaggggacaagcagcag
gagggaggcgctacgagttcggatggtccaacgcaggaaggtcgcgttacgaaggtcgag
ttgggctgggcgtcgatacagttcttcgacttcgagcggaagatgattcagggatcgtac
ttgctgtcgttgtggccgcccacggcggagaagtactttggacctgcgccggccaaggga
acccatccgctgggatcgtcgtacccgattctcggaatagaaatcccgagttacggcgga
gcggtagtgtttcccgaaccgatcaaaaatctacccccgtggagtaagttggacttcaac
agcttagatcgcaacttgcagcaggagttgatcgacacggccgaacagggctactctgca
gacaagctggaaaagcgtgaagtcttgtgggagaagcgtcactatctgcacagcttgcct
catgccttgccgaagattctgcacgcggcccacagttgggactacgcgtgccttgccgat
cttcatgccttactcaaatcgtggtccgcgatgacgccggtacaggcgctggaactgcta
ctgccacgataccccgacctggaagttcgacgacaggccgtcgagtggatctcgcacatg
ccaaacgatgaattcgtcgactatctgccccaactactgcaagcgctgaaacatgacacg
tacgaggcatctcccctgtctcgactactgctccaaaagtcgttggaatccccgcgaata
gctcatcacatgtactggctgctgttgcacagtttgcccggcgaagcgcctcagaacatg
gtcgaaatgaaccaaattgacgaagctctggtgaaccaggcccggtatcaccggcgaaac
cagctgatgttgcgcgccttgatggccacttgcggcgagaagctgaccgcgaggttcctc
tcgcagaacatgatgtgcaaaaagctaggggaagtggcgcaaagcgttaaaatcgccaaa
gaatcgcaccggctgcagatgctgaagcagggactggagtcggtcaaccaaatgctgatc
gatgctccgactgtgcttccgctgggaccgggtaatgaagtgacgggcattgttgtacgg
agttgcaactacttcaactcgaatacgctcccgttgaaggttaactttatgggtccggac
aaggtgatcgtgccggcgatcttcaaaagtggcgacgatcttcagcaggacatgctgacc
attcagatggttcggatcatggacaagctgtggttgcgcgagggactcgacctgaagatg
gtcacgttcaactgcgtgccgacggcctacaagaagggcatgatcgagatggtgtcggac
tcggaaacgctgcgcaagatccaggtcgagtggggcctgacggggtcgttcaaggacaaa
tcgatcgccgagtggctggccaagcagaaccctagtcaattagaataccagcgggctgtg
gaaaactttacgcggtcctgcgccggctactcggtggcgacctacattctcggtatttgt
gataggcataatgacaacattatgctcaaaacctcgggacatctgttccacatagatttc
ggtaaattcctcggcgacgcacaaatgtttggcaacttcaagagagatcgcaccccattc
gtcctgacctcggacatggcgtacgtcatcaacggcggcgatcgcccatcagccaaattc
cacaaatttgtcgacctttgctgtacagcgttcaacattgtgcgcaagcacggcgatctc
atcctgcacatgtttgccctgatgacgacgtccggaatcccgggcgttacggtcgaggcg
gtcaactacgtgcggaacgcactgctgccgggccagtcgaacccggaggcggcggcgtcg
ttcgccaagatgattcacatctcgctcaagtcgtggttcacgcagtttaactttttcctg
cacaacattgcgcagatgaagttttcggcggagagcgacgacggcgagctgttgagcttt
gtgccgagggtttacaccatggcccaggacggtcgactcaagtccgtaaccgtgcacggt
ttccagaagcggtacgacctggaaaagtattacacctacatcctgaaggtgacgcgacaa
aaccaaccggatccggcctacctcttccggtcgtacaaggaattctgcgagtttcaccag
aagctgtgcattcacttcccgctggccaagctgcacagcctgccgtccggcatccacgtg
ggccgctcgaacgtcaagacggtggccgagcggcgcctgccggagatccgccagttcctg
atctcgctgttcaacgcggcggacgaaattgcacattccgacctagtttacaccttcttc
catccgctgctgcgcgaccagcaggaggcggacatccacgccgccaaggttaagggcaat
cgcgccatcatggacgagtaccagcagccccggggtgagattaagttctcgctgcagtac
caccgggacgcgctcatcgtgatgatccagcacgcccgggcgctgcccacgacggccaac
aacccggagccgaacacgtacgtcaaggtgtaccttcggccggaccaggccaaggccacc
aagcgcaaaaccaaggtcgtgcggaagaactgcaatcccagctttatggaaacgctcgag
taccgactgccgctggactttatccagaaaaagacgctggaggtgacggtgtggtcgcac
gactcactgcaggagaatgcattcctcgggggctaccggttggcgctggccgagcttgat
ctgcggcacgaaatcaacgagtggttcccgctgagctacctgacgagggcttaa

DBGET integrated database retrieval system