KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004829
Entry
CpipJ_CPIJ004829  CDS       T01079                                 
Name
(GenBank) cytochrome c oxidase, subunit VB
  KO
K02265  cytochrome c oxidase subunit 5b
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00190  Oxidative phosphorylation
cqu01100  Metabolic pathways
Module
cqu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CpipJ_CPIJ004829
SSDB
Motif
Pfam: COX5B
Other DBs
NCBI-ProteinID: EDS43576
VectorBase: CPIJ004829
UniProt: B0WCK5
AA seq 119 aa
MASLCGRLMLNAAKRNITYTPVRFCKMMNDPIEHATGLEKRELLAHRAGDTDPFDMRVFK
RGPGTKENPNMIPSAFESRLVGCVCEEDQTYIQWMWLHQGHPKRCECGHWFKLVEKAPI
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcgtccctgtgcggaagattgatgctgaacgcggccaagcgtaacattacctacacg
ccggtgcgcttctgcaaaatgatgaacgacccgattgagcacgcgaccggtctggagaag
cgcgagctgctggcccaccgagccggcgacaccgatcccttcgatatgcgtgtgttcaag
cgcggaccgggcaccaaggagaaccccaacatgatcccgtccgcgttcgagtcgcgcctc
gtcggatgcgtctgcgaggaagatcagacttacattcagtggatgtggctgcaccagggt
catcccaagcgctgcgagtgcggacactggttcaagctggtcgagaaggcccccatctaa

DBGET integrated database retrieval system