KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005168
Entry
CpipJ_CPIJ005168  CDS       T01079                                 

Name
(GenBank) dolichyl-diphosphooligosaccharide protein glycotransferase
  KO
K12670  oligosaccharyltransferase complex subunit beta
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00510  N-Glycan biosynthesis
cqu00513  Various types of N-glycan biosynthesis
cqu01100  Metabolic pathways
cqu04141  Protein processing in endoplasmic reticulum
Module
cqu_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    CpipJ_CPIJ005168
   00513 Various types of N-glycan biosynthesis
    CpipJ_CPIJ005168
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CpipJ_CPIJ005168
SSDB
Motif
Pfam: DDOST_48kD DUF4350 Y_Y_Y
Other DBs
NCBI-ProteinID: EDS45144
VectorBase: CPIJ005168
UniProt: B0WE14
AA seq 453 aa
MSPVGLLVATFCVLSALVPVPVRADPGETLVLLDNLAIRETHSIFFKSLQERGYKLTYKL
ADDASLVLSKYGEFLYKHLILFAPSVEEFGGSLSVEAITDFVDNGGNVLVAGSSSAGDAL
RELASECGFEVDEENAAVIDHLNYDIADGGDHTLVVASPENLIDSEIVVGKKSVGPLLYR
GTGLLADKENPLVLQLLTADSSAYSYIPDAPIKEYPHAVGKGTLLIAALQARNNARVVFS
GSLHFFSDEAFLAPVQRAQDNKLHAKSGNQEVATAISKWVFGENGVLRVRSVKHHKEGES
NPPASYTVTEPAVYTIEIETLAENGKWQPFVANDVQLEFVRIDPFVRTTLKAIGGGRYQA
KFKIPDVYGVYQFKVDYDRIGYTQLYSTTQVSVRPLTHTQYERFIPSAYPYYVSAFSMMV
GVFVFSFIFLHYKEEGKPAAGGKATSGGDKKTQ
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgtcgcccgtaggcctgctggtggccacgttctgcgtgctgtccgcgctggtgcccgtt
ccggtgcgcgccgatcccggcgaaacgctcgtgctgctggacaacctggccatccgcgag
acgcactccattttcttcaagagcttgcaagaacgcggctacaagctgacctacaagctc
gccgacgatgccagcctggttctgtccaagtacggtgagttcctgtacaagcacctgatc
ctgttcgctccgtcggtggaggagtttggcggatcgctcagcgtcgaggccatcacggac
tttgtggacaacggggggaacgtgctggtggcgggaagttccagcgccggtgacgctctg
cgggaactcgcgtccgagtgtggcttcgaggttgacgaggagaatgcggccgtgattgac
cacttgaactacgacattgcggacggtggggatcatacgctggtcgtggcttcgccggag
aacctcatcgattcggagattgtcgtgggcaagaagagcgttgggccgttgttgtaccgc
ggaacgggtctgttggcggacaaggagaatccgctggtgctgcagctgttgacggccgat
agcagcgcgtactcgtacattccggacgccccgatcaaggagtacccgcacgccgtcgga
aaaggaactctgctgattgcggcactgcaggcccgcaacaatgcccgcgtcgtcttctcc
ggctcgttgcacttcttctccgatgaggcgttcctggcgccggttcagcgcgcccaggac
aacaaactgcacgccaagtccggcaaccaggaggtggccaccgccatcagcaagtgggtc
tttggcgagaacggcgtgctccgggtgcgttcggttaagcatcacaaggagggcgagtcc
aacccaccggcttcgtacaccgtcacggaaccggccgtgtacacgatcgaaatcgaaacg
ctcgccgaaaatggcaagtggcaaccgttcgtggccaacgacgtccagctggagtttgtg
cgcatcgatccgttcgtgcggaccacgctgaaggcgatcggcggcggacggtaccaggcc
aagttcaagattccggacgtgtacggcgtgtaccagtttaaggtggactacgaccgcatc
ggttacacgcagctgtactcgacgacgcaggtctcggttcggccgttgacccacacccag
tacgagcggttcatcccgagtgcctatccgtactacgtgagcgcgttctcgatgatggtc
ggagtgtttgtcttttcgttcatcttcctgcactacaaggaagagggaaagccggctgcc
ggtggaaaggcaacatccggtggagacaagaagactcagtag

DBGET integrated database retrieval system