KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005612Help
Entry
CpipJ_CPIJ005612  CDS       T01079                                 

Definition
(RefSeq) carnitine o-acyltransferase
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00071  Fatty acid degradation
cqu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CpipJ_CPIJ005612
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cqu03029]
    CpipJ_CPIJ005612
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     CpipJ_CPIJ005612
Mitochondrial biogenesis [BR:cqu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    CpipJ_CPIJ005612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 6037121
NCBI-ProteinID: XP_001847064
VectorBase: CPIJ005612
UniProt: B0WED0
AA seq 783 aa AA seqDB search
MAEAHSAVAFSFSITHEGWHLNYDREVLNLVWESGLRSWKKRLARFRTGVRNGVYPAHLQ
SLWLVIAVAMALHFTQRHVPFNLVGKFSALLPGDTVGYQVTACGLAGLFFWLCICYTMRY
SLKLLLMYKGWMYEKRAPGSKVSLPTRLWALCVKVLATWNKPGLYSFQGSLPRLPLPSVQ
QTMTRYLRSVRPLLDDANYTRMERLAKEFQAGIAPKLQRYLTLKSWWSTNYVSDWWEEYV
YLRGRGALMVNSNFYGIDAIFTQPTTIQSARAASVINMLLQFRRIVERQELEPILVQGLV
PLCSWQYERIFNTVRVPGVETDKIVHYQDSNHIVVLYRGCYYKVVIYHNGRILRPCELQI
QIEEILNSSDKPQAGEELLASLTAGDRTKWAKIRESVFAKGVNKTSLHLIESAAFVLSLD
TLPFEFDMAHPEKLDQFGRYLLHGNGHDRWFDKSFTVCVGSNGRIGFNSEHTWADAPVMA
HVWENIVAEEQVQKRYDENGNTLGIPEFEPPKPKRLAFDLDNPVALDAIQEAHLGAQQLL
NDVDLRIFVHDAYGKGLMKKCRLSPDAFLQMALQLAYYRDAGKFSLTYEASMTRLFREGR
TETVRPCTIESSAWVKAMNDASVGAEERVKLLNEACERHQLGYQDAMCGNGIDRHLFCLY
VVSKYLEVDSPFLKEVLSEPWRLSTSQTPHGQTAKLDLKKHPNCISAGGGFGPVADDGYG
VSYIVAGEDLIFFHISSKKTCGSTSSERFAQQIARALDDMKQLFEQHRALQAQKKGVTNG
TAK
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcccattcagctgtcgcgttctcgttctccatcacccacgagggatggcac
ctgaactacgaccgggaggtgctgaacctggtctgggagtccggcctccggtcctggaag
aagcggctcgcgcggtttcggaccggcgtccgcaacggagtctaccccgcccaccttcag
agcctttggctggtgatagcggtggcgatggcactccacttcacacaacggcacgttccg
ttcaacttagttggtaaattttcagcccttctaccgggagataccgtgggctaccaagtg
acagcatgcggcctggcggggctgttcttctggctgtgcatctgctacacgatgcggtac
tcgctgaagctgctgctcatgtacaaagggtggatgtacgagaagcgagccccgggcagt
aaagtctcgctgccaactcggctgtgggccctgtgcgtgaaggtgctggccacgtggaac
aaaccgggcctgtacagcttccagggatcgctgccgcggttgcccctgccgagtgtgcag
cagacaatgaccaggtacctccggtcggtgcgacccctgctggacgatgccaactacacc
cgcatggagcgactggccaaggagttccaggctggaatcgcgcccaaactgcagcgctat
ctgacgctgaagagttggtggtccacgaactacgtgtccgattggtgggaggagtacgtg
tacctgcgcggacgtggcgccctcatggtcaacagcaatttctacggaatcgacgctatt
ttcacacagcccaccaccattcaaagtgcccgggctgccagtgtcatcaacatgctgctg
cagttccggcggatcgtcgaacggcaagagctggaacccattctggtgcaggggctggtc
ccactgtgctcgtggcagtacgaacgtatcttcaacaccgtacgcgtgcccggcgttgaa
actgacaagattgtccactaccaggactcaaaccacatcgtggtgctgtaccgcggatgt
tactacaaggtcgtcatctaccacaacggacgcatcctacgaccgtgtgagctgcaaatc
cagatcgaagagatcctcaacagcagtgacaagccgcaggccggcgaggagctgctcgcg
tcgctaaccgccggagatcgtaccaagtgggccaagatccgcgagtcggtgttcgccaag
ggtgtcaacaagacgtcgctgcacctgatcgagagtgcggccttcgtgctgtcgctggac
acgctgccgttcgagttcgacatggcccaccccgagaagctggaccagtttgggcggtac
ttgctgcacggcaacggccacgacagatggttcgacaagagctttacggtgtgcgtcggc
agcaatggacggattggctttaattcggagcacacttgggctgatgcacctgtaatggca
cacgtttgggagaacattgtggcggaagagcaagtccagaaacgatacgacgagaacggc
aacaccctgggcattcccgagtttgaaccaccaaagccgaagcgactggcgttcgacctg
gacaatccggtcgcgctggacgccatccaggaagctcatctgggcgcccagcaactgctg
aatgacgtcgacctgcgcatcttcgtgcacgacgcgtacggcaagggactgatgaagaag
tgtcgcctgtcgccggatgcgttcctccagatggcgctgcagctggcctactaccgggac
gcgggcaagttctcgctcacgtacgaagcctcgatgacgcggttgttccgcgagggtcgc
accgaaaccgtgcgtccgtgcacgatcgagtcgtcggcctgggtgaaggcgatgaacgac
gcgagcgtgggcgccgaggagcgcgtcaagctgctgaacgaagcgtgcgagcggcaccag
ctgggctatcaggacgccatgtgcggcaatggcatcgaccggcacctgttctgtctgtac
gtcgtgtccaagtacctggaggtggattcgcccttcctgaaggaggtactcagcgaaccg
tggcggctgtccactagtcaaaccccgcacggccagaccgccaagttggatctcaagaag
cacccgaactgcatcagcgccggcgggggcttcggaccggtcgccgacgacgggtacggc
gtgtcgtacatcgtggccggcgaggacctcatctttttccacatctcgtccaagaagacg
tgcggttcgacgagttcggagcggttcgcccagcagattgcgcgggccttggacgacatg
aagcagctgtttgagcagcaccgggcactgcaggcgcagaagaagggtgtcaccaacgga
acggccaagtaa

DBGET integrated database retrieval system