KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005779Help
Entry
CpipJ_CPIJ005779  CDS       T01079                                 

Definition
(RefSeq) succinyl-CoA ligase beta-chain, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00020  Citrate cycle (TCA cycle)
cqu00640  Propanoate metabolism
cqu01100  Metabolic pathways
cqu01200  Carbon metabolism
Module
cqu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cqu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CpipJ_CPIJ005779
   00640 Propanoate metabolism
    CpipJ_CPIJ005779
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqu04147]
    CpipJ_CPIJ005779
Enzymes [BR:cqu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CpipJ_CPIJ005779
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CpipJ_CPIJ005779
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ005779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA
Motif
Other DBs
NCBI-GeneID: 6037339
NCBI-ProteinID: XP_001847263
VectorBase: CPIJ005779
UniProt: B0WEX9
AA seq 419 aa AA seqDB search
MTSLAQLSRVYPKLLAVRKAAVVASRQLNLLEYQSKKLLEQSGVAIQAFRVLEGRKDEDV
LKDFNVNEYVVKAQILAGGRGKGHFDNGFKGGVHITKDRSKVIPLVEKMVGAKLITKQTP
KDGILVKSVMVADSINIVRETYLSIVMDREHNGPVLIASPAGGMDIEAVAEETPEKIKTV
PISILAGISRAQAEDVARFLEFKGPLVQTAATEIEKLYSLFQKVDCTQIEINPLAETDDG
RVISVDAKLNFDDNAEFRQKDIFAMEVHEDTDPKEIEASKYNLNYIAMEGNIGCLVNGAG
LAMATMDIIKLNGGAPANFLDVGGNVKEDQVLKAFQILTSDQNVKAILVNVFGGIVNCAT
IANGIVNATKVIGLRVPLVVRLEGTNVNAAKKILQESGLKIESAQDLDEAAKKAVQAIS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacttgcccagctgtcccgcgtctacccgaagctgttggccgttcgtaaggcg
gcggtggtcgcatcccgccagctgaacctgctcgagtaccagagcaagaagctgctggag
cagagcggtgtggccatccaggcgttccgggtgctcgagggccgcaaggacgaggacgtg
ctaaaggatttcaacgtcaacgagtacgtggtgaaggcgcagattctcgccggcggccgg
ggcaaaggtcatttcgataatggcttcaagggaggcgtgcacatcacgaaagatcgttcc
aaggtgatcccactggtggagaagatggtcggcgccaaacttatcaccaagcaaaccccc
aaggatggaatcctcgtcaaatcggtaatggtcgcggacagcataaacatcgtacgggaa
acttacctgtcgattgttatggatcgcgagcacaatggaccagtattgatcgcctcgccg
gccggcggtatggacatcgaagcggtggccgaagaaacgccggagaaaatcaaaaccgtc
cccatctcgatcctcgcgggcatcagccgtgcccaggccgaagacgtggcgcgcttccta
gagttcaagggacccctggtacagacggcagccacggaaatcgaaaagctctactcgctc
tttcagaaggtagactgcacccagatagaaatcaacccgctagcggaaacggacgacggt
cgggtgatctcggtcgacgcaaaactcaactttgacgacaacgccgagttccggcaaaag
gacatctttgcgatggaagtgcacgaggacacagatcccaaggaaatcgaagccagcaaa
tataacctaaactacatagccatggagggaaatatcggctgtctggtcaacggtgcaggc
ctggcgatggccacgatggacatcatcaagctgaatggaggcgcgcccgcaaacttcctc
gacgtcggcggaaacgtcaaagaagaccaagtactgaaagccttccagatcctcacctcg
gaccagaacgtgaaggccatcctggtaaacgttttcggaggcatcgtaaactgtgctacc
atcgcgaacggaatcgtgaacgccaccaaggtcatcgggctgcgggttccgctggtggtg
cggctcgaaggaacgaacgtgaacgccgcgaagaagatactgcaagagtcggggcttaag
atcgaatccgcccaggacttggacgaggcggccaagaaggcggtgcaggcgattagttag

DBGET integrated database retrieval system