KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005818
Entry
CpipJ_CPIJ005818  CDS       T01079                                 
Name
(GenBank) 13 kDa ribonucleoprotein-associated protein
  KO
K12845  U4/U6 small nuclear ribonucleoprotein SNU13
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03008  Ribosome biogenesis in eukaryotes
cqu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CpipJ_CPIJ005818
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    CpipJ_CPIJ005818
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cqu03041]
    CpipJ_CPIJ005818
   03009 Ribosome biogenesis [BR:cqu03009]
    CpipJ_CPIJ005818
Spliceosome [BR:cqu03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    CpipJ_CPIJ005818
Ribosome biogenesis [BR:cqu03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    CpipJ_CPIJ005818
SSDB
Motif
Pfam: Ribosomal_L7Ae RNase_P_pop3 PELOTA_1 ParB_C
Other DBs
NCBI-ProteinID: EDS27034
VectorBase: CPIJ005818
UniProt: B0WGK5
AA seq 127 aa
MTEEVNPKAYPLADQALTSKIMTLIQQAVNYKQLRRGANEATKTLNRGLSEFIVMAADAE
PLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTINEGSQLKSQIVTIQQ
EIERLLV
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaccgaagaggtaaacccgaaagcctacccgctggcggaccaagccctcacgtccaag
attatgacgctgatccagcaggcggtcaactacaagcagctgcgtcgcggcgccaacgag
gccaccaagacgctgaaccgtggcctctcggagtttatcgtgatggccgcggacgccgaa
ccgctcgaaattatcctccatttgccgctgctgtgcgaggacaagaacgtgccgtacgtg
ttcgtgcgctccaagcaggccttgggccgtgcgtgcggcgtgtcgcgtccgatcgtcgcc
tgctccgtcaccatcaacgagggctcccagctcaagtcgcagatcgtgacgattcagcag
gagattgagcgtctgctggtttaa

DBGET integrated database retrieval system