KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006003
Entry
CpipJ_CPIJ006003  CDS       T01079                                 
Name
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00860  Porphyrin metabolism
cqu01100  Metabolic pathways
cqu01240  Biosynthesis of cofactors
Module
cqu_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    CpipJ_CPIJ006003
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqu04147]
    CpipJ_CPIJ006003
Enzymes [BR:cqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CpipJ_CPIJ006003
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ006003
SSDB
Motif
Pfam: ALAD
Other DBs
NCBI-ProteinID: EDS26038
VectorBase: CPIJ006003
UniProt: B0WF62
AA seq 328 aa
MSLTKLHSSIFHPTLRKLQCQDVDIAAHNLMYPIFLVEDDDAIQEIPSMPGVARYGINPL
KKHLTPLVEKGLASILLFGVVEKLPKDPTGTGADSKDNPVVKALPLLRKWFPDLLIACDV
CLCPYTSHGHCGVLTEDGVIDNEPSIQRIAEISLAYARAGAQIVAPSDMMDNRIWAIKKI
LRENKLENRVSVLSYSVKFASGFYGPFRDAAKSAPAFGDRKCYQLPPGSKGIARRAAKRD
VEEGADMLMVKPGMAYLDIVKQVKDDYPELPLFIYQVSGEYSMLLNAGKIGAFDLRTVLW
EVLVGMRRAGADCIITYFTPTLLDWLRE
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtccctgacgaagctccacagcagcatcttccacccgacgttgcgcaagctccagtgc
caggacgtggacattgcggcgcacaatttgatgtatccgatctttctggtggaagatgac
gatgcgattcaggagattcccagcatgcccggagtggcccggtacgggatcaacccactt
aagaagcatttgacgccgttggtcgagaagggactggcgtcgattttgctgttcggagta
gtggaaaagttgccgaaggaccccaccggcaccggcgccgactcaaaggacaaccccgtg
gtcaaagcgctgccgctgctccgcaaatggttccccgatctgctgattgcctgcgacgtg
tgcctctgtccgtacaccagccacggtcactgcggtgtcctcacggaggacggcgtcatc
gacaacgaacccagcatccagcggatcgcggaaatctcgctggcctatgcccgggctggg
gcgcagattgtggccccgtcggacatgatggacaaccggatttgggcgatcaagaagatt
ttgcgggagaataagctggagaatcgcgtttcggtgctgtcgtactcggtcaagtttgcg
tccggattttacggaccgttccgggatgcggccaaatcggcaccggcctttggggatcgc
aagtgctaccagctgccgccgggatcgaagggaattgcacgacgagctgcgaaacgtgac
gtcgaagaaggcgccgatatgctgatggtcaagcccggcatggcctacttggacatcgtc
aagcaggtgaaggacgactatccggagcttccgctgttcatctaccaggtgtccggcgag
tactcgatgctgctgaacgccggcaagatcggcgcgttcgacctgcggacggtgctgtgg
gaggttctggtgggaatgcgccgggccggggcggattgcatcatcacgtactttacgccc
acgctgctcgactggctgcgggagtag

DBGET integrated database retrieval system