KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006029Help
Entry
CpipJ_CPIJ006029  CDS       T01079                                 

Definition
(RefSeq) hypothetical protein
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cqu01002]
    CpipJ_CPIJ006029
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqu04147]
    CpipJ_CPIJ006029
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     CpipJ_CPIJ006029
Peptidases [BR:cqu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   CpipJ_CPIJ006029
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   CpipJ_CPIJ006029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 6037460
NCBI-ProteinID: XP_001847372
VectorBase: CPIJ006029
UniProt: B0WF88
AA seq 405 aa AA seqDB search
MKMNRAEQQEGDWIGEICLATCKICILVFVIIFIVLPLIFKFSFALQKGILFLTFITYPP
NLDLKRPEKSGLYATRNFYITYRDQEEDIDVDIAVWHVLPNDLVRRFGRELQMDEATLAN
VTAPEEMRSELDKVSNKDASKYHEIEKILARDGLNLEDDDTRRELFEASLKATTNDIVLY
LHGNSASRGASHRVDLYKLLRSLNYHVITLDYRGYGDSANLSPTERGVVYDSLAVYQYIT
SVSKNPVYLWGHSLGTGVATHLLSLLTDMSMPGPRALVLESPFNNIREEICAHPFSKLYR
HLPWFDYTISKPMYANELRFESDQHIAEFRQPVLILHAEDDHVVPFHLGYKLYRTALDTR
GKSWGPVEFHRFERTSHYGHRYICRAPNLPEIVIRFFRTYRDEQY
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaccgcgccgaacagcaggagggggattggatcggcgaaatatgcctggcg
acgtgcaagatctgcatcctggtgtttgtgatcatcttcatcgtgctgccgttgatcttc
aaattttcctttgccctgcagaaaggcattctgtttctcacgttcataacctacccgccg
aacctggacctgaagcggccggagaagagcggtctgtacgcgacgcggaacttttacatc
acctaccgcgaccaggaggaggacatcgatgtcgacattgccgtgtggcacgtgctgccc
aacgatctggtgcggcggtttggccgcgagctgcaaatggatgaggcaaccctggccaac
gtgaccgctccggaggagatgcgatccgaactggataaagtgtccaacaaggacgcgtca
aagtatcatgaaatcgaaaagattctcgcccgggacggactcaacctggaggacgacgac
acccgacgggagttgttcgaggccagcctgaaggcgaccacgaatgatattgtgctgtac
ctgcacgggaatagcgcctcccgaggggcgtcccatcgcgttgatttgtacaaactgttg
cgcagcttgaactaccacgtgattacgctggactaccgcgggtacggagattcggcgaat
ctatcgccgacggaacgtggcgtagtttacgattcgttggccgtgtatcagtacatcaca
agtgtaagcaagaatccggtgtatttgtggggtcactcgctgggaacgggcgtcgcgacg
cacctgttgtcgctgctgacggacatgagcatgccgggaccgagggcgctcgtgctggag
agtccgtttaataatataagggaggagatttgcgcgcatccgttttcaaagttataccgt
cacctgccctggttcgactacacgatctcgaagccgatgtacgccaacgagctgcggttc
gagtcggaccagcacattgccgagttccggcagccggtgctgattctgcacgccgaggac
gaccacgtggtgccgttccatctcggatataagctttatcgcaccgcgctcgatacccgc
ggcaagtcgtggggcccggtcgagttccaccggttcgagcgcaccagccactacggccac
cggtacatttgccgtgcgccgaacctgccggagattgtgatccggttcttccgcacgtac
cgcgacgagcagtactag

DBGET integrated database retrieval system