KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006068
Entry
CpipJ_CPIJ006068  CDS       T01079                                 
Name
(GenBank) utp-glucose-1-phosphate uridylyltransferase 2
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00040  Pentose and glucuronate interconversions
cqu00052  Galactose metabolism
cqu00500  Starch and sucrose metabolism
cqu00520  Amino sugar and nucleotide sugar metabolism
cqu01100  Metabolic pathways
cqu01240  Biosynthesis of cofactors
cqu01250  Biosynthesis of nucleotide sugars
Module
cqu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
cqu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CpipJ_CPIJ006068
   00052 Galactose metabolism
    CpipJ_CPIJ006068
   00500 Starch and sucrose metabolism
    CpipJ_CPIJ006068
   00520 Amino sugar and nucleotide sugar metabolism
    CpipJ_CPIJ006068
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CpipJ_CPIJ006068
SSDB
Motif
Pfam: UDPGP
Other DBs
NCBI-ProteinID: EDS26266
VectorBase: CPIJ006068
UniProt: B0WFJ8
AA seq 513 aa
MTGAIDILLKVRGHQRVPSDTKEFHEATKRDALIRLRKDLDNLLHSADDDKKATVQKEMC
GFEALFHRFLQEDGPSVEWDKIEKLPQDAVKDYSSLKTPQESEIRAMLDKLVVVKLNGGL
GTSMGCHGPKSVIPVRNDLTFLDLTVQQIEHLNKKYSANVPLVLMNSFNTDEDTEKVIRK
YKGFQVQIYTFNQSCYPRISRDSLLPVAKDFNIEADIEAWYPPGHGDFYQSFQNSGLLKK
FIDEGRDYCFLSNIDNLGATVDINILNRLLGSDRQGDKPIEFVMEVTDKTRADVKGGTLI
QYEHKLRLLEIAQVPKEHVDDFKSVKTFKFFNTNNIWARLESIERVLNARTMNMEIIVNN
KTLDNGMRVIQLETAVGAAMKCFDDGIGINVPRSRFLPVKKTSDLLLVMSNLYSLKYGSL
VMSPQRMFPTTPLVKLGDNHFSKVKEFLGRFANIPDLIELDHLTVSGDVTFGRGVSLRGT
VIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgacgggggcgatcgacatactgttgaaagttcgcggccaccagcgtgtcccgtccgac
acgaaggagttccacgaggccaccaagcgtgatgcgttgatccgtttgcgcaaagatttg
gacaatctgctgcactcggccgacgatgacaaaaaggcgaccgtccagaaggaaatgtgc
ggcttcgaggccctgttccatcgcttcctgcaggaggacggcccgtcggtcgagtgggac
aaaatcgagaagctgccccaggatgccgtcaaggattactccagcctgaagacgccccag
gagtcggagattcgtgccatgctggacaaactggtcgtggtcaagctgaacggtggtctc
ggaacgtcgatgggttgccacggaccaaagtccgtcattccggtgcgtaacgaccttaca
ttcctggatttgaccgtgcagcagattgagcacctgaacaaaaagtacagcgccaacgtg
ccgctcgtgctgatgaactcgttcaacaccgacgaggacaccgaaaaggtcatccgcaag
tacaagggattccaggtccagatttatacctttaaccagagctgctacccgcgcatcagc
cgagactcgctgctgccggtggcgaaggatttcaacatcgaagctgacattgaggcatgg
taccctcccggtcacggtgatttctaccagtcgttccagaactcgggtctgctgaagaag
ttcatcgacgaaggccgcgactattgcttcctgtctaacattgataacttaggcgcaacg
gttgacatcaacattttgaaccgattgctcggcagcgatcgccagggtgacaagccgatc
gagtttgtgatggaagtgaccgacaagactcgggctgacgttaagggtggtaccttgatc
cagtacgagcacaagctgcgactgctggaaatcgctcaggtcccgaaagagcacgtcgat
gacttcaagtcggtgaagacgttcaagttcttcaacaccaacaatatttgggcccgtttg
gagtcgatcgaacgtgtcctgaatgcgcgcacaatgaacatggagatcatcgtcaacaac
aaaacgctggacaatggcatgcgcgtgattcagctggagacggccgtcggtgcggcgatg
aagtgcttcgacgatggaatcggaatcaacgttccgcggtcacgcttcttgccggtcaag
aaaacgtccgatctgctgctggtcatgtccaacctgtacagtctcaagtacgggtcgctt
gtcatgtcgccgcagcgcatgttccccacgacgcccctggtcaagctgggagacaatcac
ttcagcaaggtcaaggagttcctgggacgcttcgcaaatattcccgacctgatcgagctg
gaccatttgaccgtttcgggagatgtcacgttcggccgtggagtgtcgttgcgtggaacg
gtcattatcattgccaaccatggtgatcggatcgatattcctgcgggagccatcctggag
aataagatcgtatccggtaatatgcgcattctggatcactaa

DBGET integrated database retrieval system