KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006139Help
Entry
CpipJ_CPIJ006139  CDS       T01079                                 

Definition
(RefSeq) mitochondrial ribosomal protein, L53
  KO
K17434  large subunit ribosomal protein L53
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cqu03011]
    CpipJ_CPIJ006139
Ribosome [BR:cqu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CpipJ_CPIJ006139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 6037696
NCBI-ProteinID: XP_001847583
VectorBase: CPIJ006139
UniProt: B0WFU9
AA seq 146 aa AA seqDB search
MSIKVGGTFSRSGGIVSAIGKQLKMLNLKAVQRITVTFDPFHESAVPTREFLHHLSAPKI
GQTNPSCVLRSEVVCDRRPPSVVFQLIPSVQAEAKLKKIELNGANLTTLELLQLCNKHIT
ALAPKEIATSTVKTKSEKKAGGGKRR
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcaaggtgggaggaacgttcagccggtccggcggcatcgtgtccgctattggc
aagcagctgaagatgctcaacctgaaggcggttcagcgcattacggtcacctttgatccg
ttccacgagagtgccgttccgacgagggaatttctgcaccacctgtccgcgcccaagatc
ggccaaacgaacccctcgtgcgtgctccgctcggaagtggtctgcgaccggcgcccgccc
tcggtcgtgttccagctcatcccctcggtgcaggcggaagccaagctcaaaaagatcgaa
ctgaacggcgccaacctgaccacgctggaactgctgcagctgtgcaacaaacacatcacg
gcgctcgcccccaaggagatcgccaccagcaccgtcaagaccaagtccgagaagaaggcc
ggcggcggcaagcgacgataa

DBGET integrated database retrieval system