KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006702
Entry
CpipJ_CPIJ006702  CDS       T01079                                 
Name
(GenBank) 26S proteasome non-ATPase regulatory subunit 1
  KO
K03032  26S proteasome regulatory subunit N2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03050  Proteasome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    CpipJ_CPIJ006702
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:cqu03051]
    CpipJ_CPIJ006702
Proteasome [BR:cqu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     CpipJ_CPIJ006702
SSDB
Motif
Pfam: PC_rep RPN2_C HEAT_2 HEAT_EZ
Other DBs
NCBI-ProteinID: EDS27943
VectorBase: CPIJ006702
UniProt: B0WHS6
AA seq 1029 aa
MKLNITSAAGIICLLDEPIQELKVFALKKLDTIVDEFWPEISEAVEKIEILHEDKGFQQH
DLAALVASKVYYHLGSFEDSLTYALGAGDLFDVNARNEYVDTIIAKCIDHYTQLRVQLAE
NPAKAKPIDARLEAIVNRMIQRCLDDGQYRQALGIALETRRMDVVESSIMKADDIAGMLA
YAFQVTMSLIQNRAFRNTVLRCLVGLYRNLGVPDYVNMCQCLIFLEDPLAVAELLDNLTK
GGEHSVLMAYQIAFDLYESATQQFLGQVLQALKATAPIPSALISNLKPQGTNAAGAAAAP
EVKQEPKEVGEESEGGDVKIERTVDSLNESEKTHQANIEKLAGILSGEITIDLQLQFLIR
SNHADLQILRATKEAVRVSICHTATVIANAFMHSGTTSDQFLRDNLEWLARATNWAKLTA
TASLGVIHRGHETESLALMQSYLPKESGPSSGYSEGGGLYALGLIHANHGANIIDYLLQQ
LKDAQNENVRHGGCLGLGLAAMGTHRQDVYEQLKFNLYQDDAVTGEAAGIAMGMVMLGSK
HAPAIEDMVAYAQETQHEKILRGLAVGISLTMYARLEEADSLVTSLSNDKDPVLRRSGMY
TIAMAYCGTGNNQAIRKLLHVAVSDVNDDVRRAAVTAIGFILFRTPEQCPSVVSLLAESY
NPHVRYGAAMALGIACAGTGLREAIALLEPMAKFDPVNFVRQGALIASAMILIQQTDQTC
PKVTFFRQLYTQVITNKHEDVMAKYGAILAQGIIDAGGRNVTVSLQSRTGHTNLQAVVGM
LVFTQYWYWFPLAHCLSLAFTPTCLIALNSDLKMPKVDLKSAARPSLYSYPAPLEEKKRE
ERDKVATAVLSLAARAKRRTGDKKKDNAKDADSKMDVDDEASATPPKDDLSATVKAKEEA
KTTPVKEDKKKEAKPKDAATPSPAPAEETPANAAAATAAEKKTPKEPEPSFEILHNPARV
MRAQLKVISIAEGTPFTPLKDVAIGGIVMMQHNAAAGEQVLVERVTAYGPKNDDLKEPEA
PEPFEYIED
NT seq 3090 nt   +upstreamnt  +downstreamnt
atgaagctaaacataacttccgccgccggcatcatctgcctgctggacgaaccgatccag
gagctgaaggtgtttgcgctgaagaagctggacacgatcgtggacgagttttggccggag
atttccgaggcggtggagaagatcgagattctgcacgaggacaagggcttccagcagcac
gatttggccgcgctggtggcttccaaggtttactaccatttggggtcgttcgaggactcg
ctgacgtatgcgctgggcgcgggagatttgttcgatgtgaacgcgcgcaacgagtacgtg
gacacgatcatcgccaagtgtattgatcattatacgcagttgcgggtgcagctggcggag
aatccggccaaggcgaagccgatcgatgcgaggttggaggcgatcgtgaatcggatgatt
cagcgctgtttggacgatggacagtacaggcaggcgctggggattgcgctggagacgcgc
cgaatggacgtggtggagtcgtcgatcatgaaggcggacgacattgccgggatgttggcg
tacgcgtttcaggtcaccatgagcctgattcagaatcgcgcgttccgaaacacggtgctg
cgctgtctcgttggactgtaccgcaatttgggcgttccagactacgtcaacatgtgccag
tgtctgatcttcctggaagatccgctggccgtcgctgaactgctggacaacctgaccaag
ggcggggagcactcggttctgatggcgtaccagatcgcgttcgatttgtacgagtcggcc
acgcagcagttcctgggacaggtgctgcaagcgctcaaagccacggcgccgattccgtcg
gcgttgatttccaacttgaagccgcagggcacgaacgctgctggggcggcagctgcgccg
gaagttaagcaggaaccgaaggaggttggggaggagagcgagggtggcgatgtcaagatt
gaacgcaccgtggacagtttgaacgagagcgagaagacgcaccaggcgaacattgagaag
ctggcgggaattttgtctggggagattacgatcgatctgcagttgcagttcctgatccgg
agcaaccacgcggatttgcagattctacgcgcgacgaaggaggcggttcgggtgtcgatt
tgccacacggcgacggtcattgcgaacgcgtttatgcacagcggcacgacgagcgatcag
ttcctgagggataatttggagtggttggccagggctacgaattgggccaagttgacggcg
acggcctcgctgggagtgatccaccgcgggcacgagacggaatcgcttgcgttgatgcag
agttatctgccgaaggagagcggaccgagctccgggtattccgagggtggtggcctgtac
gcgctcgggttgatccacgccaatcacggggcgaacattatcgactatctgctgcagcag
ctgaaggacgcccagaacgagaacgttcgccacggagggtgtttggggttgggtttggcc
gcgatgggaactcaccggcaggacgtgtacgagcagttgaagttcaacctgtaccaggac
gatgccgttacgggtgaggcggctggaatcgccatgggaatggtcatgctcggttcgaag
cacgctccggccatcgaggacatggtcgcgtacgcccaggagacccagcacgagaagatc
cttcgtgggttggcggtcggaatttcgctgaccatgtacgcacggttggaggaggcggat
tcgctggtgaccagcctgtccaacgacaaggacccggtgctgcgtcgcagtggaatgtac
accattgctatggcctactgcggaaccggtaacaaccaagcgatccgcaagctgctgcac
gtggctgtcagcgatgtcaacgacgatgttcgtcgtgccgccgtcaccgccatcggattc
atcctgttccgtacgccggagcagtgcccatcggttgtgtccctcctggccgagtcctac
aacccgcacgtccgttacggagctgccatggctcttggaatcgcctgcgccggaaccggc
ctccgcgaagcaatcgccctcctcgagccgatggccaagttcgaccccgtcaactttgtc
cgccagggcgccctcatcgcctcggccatgatcctgatccagcaaaccgaccaaacctgc
cccaaggtcaccttcttccgtcaactctacacccaggtcatcaccaacaagcacgaggac
gtgatggccaagtacggcgccatcctggcccagggcatcatcgacgccggtggccgcaac
gtcaccgtcagcctccaatcccgcaccggccacaccaacctccaggccgtcgtcggaatg
ctcgtcttcacccagtactggtactggttcccgctcgcccactgtctctccctcgccttc
accccaacctgcctgatcgcactcaactccgacctcaaaatgcccaaggttgacctcaaa
tccgccgcccgcccctccctctacagctacccggcccctctcgaggagaagaagcgcgaa
gaacgcgacaaggtcgccaccgccgtcctctccctcgcggcccgcgccaagcgtcgcacc
ggagacaagaaaaaggacaacgccaaggacgccgactccaagatggacgtcgacgacgaa
gccagcgccacccctcccaaggacgacctgtccgccacggtcaaggccaaggaggaagcc
aaaaccacccccgtcaaggaggacaaaaagaaggaggccaagccgaaggacgccgccact
ccgtctccggcccccgccgaagaaaccccggcaaacgccgccgctgcgactgcagcggag
aagaagacccccaaggaaccggaacccagcttcgagattctgcacaacccggcccgggtg
atgcgcgcccagctgaaggtgattagcattgccgaggggacgccgttcaccccgctgaag
gacgtcgccatcggggggatcgtgatgatgcagcacaatgcggccgctggcgagcaggtg
ctggtggagcgcgttacggcgtacggaccgaagaatgacgacctgaaggagccggaagcg
ccggagccgttcgagtatattgaggattaa

DBGET integrated database retrieval system