KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006764
Entry
CpipJ_CPIJ006764  CDS       T01079                                 
Name
(GenBank) 40S ribosomal protein S20
  KO
K02969  small subunit ribosomal protein S20e
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CpipJ_CPIJ006764
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cqu03011]
    CpipJ_CPIJ006764
Ribosome [BR:cqu03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    CpipJ_CPIJ006764
SSDB
Motif
Pfam: Ribosomal_S10
Other DBs
NCBI-ProteinID: EDS27749
VectorBase: CPIJ006764
UniProt: B0WHH1
AA seq 120 aa
MAATGKDIEKPVAEAATVHRIRITLTSRNVRSLEKVCADLISGAKKQKLRVKGPVRMPTK
ILRITTRKTPCGEGSKTWDRFQMRLHKRIIDLHSPSEIVKQITSINIEPGVEVEVTIADP
NT seq 363 nt   +upstreamnt  +downstreamnt
atggccgccactggaaaggacatcgagaagcccgttgccgaggccgcgaccgttcaccgg
atccgcatcacgctgacctcgcgcaatgtccgcagcctggagaaggtgtgcgctgacctg
atcagcggcgccaagaagcagaagctgcgcgttaagggcccggttcgcatgccgaccaag
atcctgcgtatcacgacccgtaagacgccttgcggtgagggttccaagacttgggatcgt
ttccagatgcgcctgcacaagcgtatcatcgatctgcactcgccgtccgagatcgtcaag
cagatcacctcgatcaacatcgagcccggtgtagaggtcgaggtcaccatcgccgaccct
taa

DBGET integrated database retrieval system