KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006851Help
Entry
CpipJ_CPIJ006851  CDS       T01079                                 

Definition
(RefSeq) myotubularin
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00562  Inositol phosphate metabolism
cqu01100  Metabolic pathways
cqu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CpipJ_CPIJ006851
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CpipJ_CPIJ006851
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cqu01009]
    CpipJ_CPIJ006851
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     CpipJ_CPIJ006851
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     CpipJ_CPIJ006851
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    CpipJ_CPIJ006851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase Y_phosphatase3 DSPc RVT_1
Motif
Other DBs
NCBI-GeneID: 6038625
NCBI-ProteinID: XP_001848399
VectorBase: CPIJ006851
UniProt: B0WI65
AA seq 548 aa AA seqDB search
MQDIKNDVSYICPYSGPVVGTLTITNYRLHFRSNPPASDKDPIVIVDCPLGAVSRVEKVG
GASSRGENSYGIDIFCKDMRNLRFAHKQENHSRRTVYEKLQLYSFPLSHNGQLFAFNYKE
KFPEEGWNVYEPVAELRRMGVNSTNNDTWRITRINEKYELCDSYPSVWAVPKSAKDEMLK
QVANFRSRSRLPVLCWIHPKSLATITRCSQPLVGVSGKRSEADETYINYIMEANAQSDKL
SIFDARPNANAIANKAKGGGYESEDSYKHVELTFLDIHNIHVMRESLRKLKEICFPASDD
QKWLSAVEGTLWLKHIKCILAGAVRIVDRIENMRMSVVVHCSDGWDRTSQLTALAMLLLD
PYYRTLKGFQVLIEKEWLSFGHKFEQRIGHGDNHHSDADRSPVFLQFMDCVWQISKQFPH
ALEFTEYFLITVLDHLYSCRFGTFLYNTERERTQNAGQILEKCREYNVPTHHLFIDVKAA
HDTVDREQLWQIRHKNGFPGQTDSADQGYLGSCDVSQESGRGASGPLLIAPRVTAYPMCC
LKSDLREL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacatcaaaaacgacgtctcgtacatttgcccgtacagcggacccgtcgtcgga
acgctcacaatcaccaactaccggctgcacttccggtcgaaccccccggccagcgataag
gatccgatcgtgatagtggattgtccgctgggtgcggttagtcgggtggagaaagtgggc
ggggccagctcgcggggcgagaactcgtacgggattgacattttctgcaaagacatgcgg
aatttgcgttttgcccacaagcaggagaatcactcgcggaggacggtctacgagaagctg
cagttgtattcgttcccgctgtcgcacaacggacaactgtttgcgttcaactataaggaa
aagttccccgaggagggttggaacgtgtacgagccggtggcggaactccggcggatgggc
gtcaacagcaccaacaacgacacctggcggattacgaggatcaacgaaaagtacgaactg
tgcgacagttatccgtcggtttgggccgttccaaagtcggccaaggacgaaatgctcaaa
caggtggcaaacttccggtcacgcagtcgtcttccggtgctgtgctggatccatccaaag
tcgctcgccacgatcacgcgttgttcccagccgctggttggagtcagtggaaaacgtagc
gaagcggacgaaacgtacatcaactacatcatggaggcgaacgcccagtcggacaagctg
tcgatctttgacgcgcggccaaatgcgaacgccatcgcgaacaaggccaagggtgggggt
tacgagtcggaggattcgtacaagcacgtggagttgaccttcctggacattcacaacatt
cacgtgatgcgcgagagcttgcggaagctgaaggagatttgcttcccggcgagcgacgac
cagaagtggctttccgcggtggagggaacgctgtggctgaagcacatcaagtgcattctg
gcgggtgcggtgcggattgtggataggatcgaaaacatgcgcatgtccgtggtggtccac
tgttccgacggctgggaccgcacctcacagctaacggccctcgcaatgctgctgctggat
ccgtactaccgcaccctgaagggcttccaggtgctcatcgagaaggaatggctcagcttt
gggcacaagttcgaacagcgcattggccacggcgacaaccaccactcggacgcggaccgg
tcgccggtgtttctccagtttatggactgcgtgtggcagatctcgaagcagttcccgcac
gcgctcgagttcaccgagtactttctcatcacggtgctggaccacctgtactcgtgccgg
ttcgggacgttcctgtacaacacggagcgggagcgcacccagaatgcgggtcagatcctc
gagaaatgccgtgagtacaacgtgcccacacatcacttgttcatcgatgtcaaggcagcg
cacgatacagtcgaccgcgagcagctatggcaaatcaggcacaagaatggtttccctgga
caaactgactcggctgatcaaggctaccttggatcgtgtgatgtatcacaggagagtggc
agaggagctagcggaccccttttaatcgcaccaagggtgacggcttatccaatgtgctgt
ttaaaatcggacttgcgggagttgtga

DBGET integrated database retrieval system