KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007071Help
Entry
CpipJ_CPIJ007071  CDS       T01079                                 

Definition
(RefSeq) biotin-protein ligase ligase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00780  Biotin metabolism
cqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CpipJ_CPIJ007071
Enzymes [BR:cqu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     CpipJ_CPIJ007071
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     CpipJ_CPIJ007071
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     CpipJ_CPIJ007071
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     CpipJ_CPIJ007071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C
Motif
Other DBs
NCBI-GeneID: 6038901
NCBI-ProteinID: XP_001848600
VectorBase: CPIJ007071
UniProt: B0WIR6
AA seq 397 aa AA seqDB search
MKENNAFDERRSARSFSTTKRDGRIEFVPYEDNKQNLGIFKHVLSSELGIKFKTSHDHEA
SCYQSAFLIGSEEVKRSFLSDLSIPNELKVSDLTLQFCSKSDLIPAASESHLPVLTDQPP
EDFSTQFFNDHLKTNKIGRLTLYLPLVTSSMIIVSNATLPHGFVAIPRRQSRGTGRNRNQ
WLSPDGCAMFSLQLHVPLDSPLGQRLPMVQHLVALGIVLGIRNQPGYGELDVRLKWPNDV
YANGRSKLGGIIVNSQLEGSRAVVNVGCGVNLSNSTPTTCVNDVIGEFNRERRERLRALG
YEQLLAQIFNEIERIFEEVQRGKVEVLYDLYRRYWLHEGQSVTIRDRDGLDVTGTVAGID
EYGYLLVKVDGAGQPICVHPDGNSFDMMKGLIIPKYC
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaacaacgcgttcgacgagcgacgctcagcaagaagtttctcgaccaccaaa
cgagacggtcgtatcgagtttgtcccatacgaagacaacaagcagaacctggggatcttc
aagcatgtgttaagctcagaacttggaataaagttcaagacatcacacgatcatgaagct
tcctgctatcaaagtgccttcctaattggttcagaagaagttaagcgtagtttcctgagc
gacctaagtattcccaacgagctcaaggtcagcgatctaacgctacagttctgctccaaa
tcagacctcatcccagcggcgtccgaatctcatctcccagttctcacagaccaacccccg
gaagacttctccacccaattcttcaacgatcacctcaaaacaaacaaaatcggccgcctt
accctgtacctccccctcgtcaccagctccatgatcatcgtatcgaacgcgaccctgccg
cacggcttcgtcgccatcccacgccgtcaatcgcgcggaaccggccgaaaccgcaaccag
tggctcagcccggacggttgtgccatgttctccctccaactgcacgtcccgctggacagt
ccgctcggccagcgactcccaatggttcagcacctggtcgcactgggcatcgtgctcggg
attcggaaccaacccgggtacggcgagctggacgtgcggctcaagtggccaaacgacgtg
tacgccaacggaaggagcaaactgggtgggatcatcgtcaactcgcagttggagggatcg
cgggccgtcgtgaacgttggttgcggggtaaatttgagtaactcgacgccgacgacgtgc
gtgaacgatgtgatcggcgagtttaatcgggagaggagggagcgattgagggcgttgggg
tacgagcagctgttggcgcagatattcaacgagattgagcggatctttgaagaggttcag
cgagggaaggtggaagtgttgtacgatttgtacaggaggtattggttgcacgaaggacag
agtgtaacgattcgggatagagatgggctggacgttaccggaacggttgccggtatcgac
gagtacggatatttgctggtgaaggtggatggagctgggcagccaatttgtgtgcatccg
gacgggaatagtttcgacatgatgaagggattgatcattccaaagtactgctag

DBGET integrated database retrieval system