KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007723
Entry
CpipJ_CPIJ007723  CDS       T01079                                 

Definition
(RefSeq) transport protein Sec61 subunit alpha 2
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03060  Protein export
cqu04141  Protein processing in endoplasmic reticulum
cqu04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CpipJ_CPIJ007723
   04141 Protein processing in endoplasmic reticulum
    CpipJ_CPIJ007723
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CpipJ_CPIJ007723
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cqu02044]
    CpipJ_CPIJ007723
Secretion system [BR:cqu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   CpipJ_CPIJ007723
SSDB
Motif
Pfam: SecY Plug_translocon
Other DBs
NCBI-GeneID: 6040852
NCBI-ProteinID: XP_001850184
VectorBase: CPIJ007723
UniProt: B0WNA0
AA seq 476 aa
MGIKFLEVIKPFCSILPEIAKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWIRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MVITIGQAIVYVMTGMYGDPAEIGAGVCLLIIIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPATVNTGRGTEFEGAVIALFHLLATRQDKVRGLREAFYRQNLP
NLMNLLATVLVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSN
LYVISQMLAVKFHGNFLINLLGVWADVGGGGPARSYPIGGLCYYLSPPESLGHIVSDPIH
AVLYIIFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHRENSMIHELNRYIPTA
AAFGGLCIGALSVLADFMGAIGSGTGILLAVTIIYQYFEIFLKEQSEMGGMGTLLF
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgggcattaaattcttggaggtcatcaaacccttctgcagcatcctgccggagattgcg
aagccggagcgcaagatccagttccgcgagaaggtgctatggacggccatcacgctgttc
atcttcctggtgtgctgccagattccgctgttcggaatcatgagctccgactcggccgat
cccttctactggattcgtgtcatcctggcgtcgaatcgaggaacgctgatggaacttggc
atttcgccgatcgtgacgtccggtttgatcatgcaactgctggccggtgcgaagatcatc
gaggtcggtgacactccgaaggatcgagcactgtttaacggagcgcagaagctgttcgga
atggtcattacgatcggacaagcgattgtgtacgtcatgacggggatgtacggcgatccg
gccgagattggcgccggagtttgtctgctgatcatcatccagctgtttgtggcgggtttg
atcgtgctgctgttggacgaacttcttcagaagggatacggcctgggatcgggaatttcg
ctgtttatcgctacgaatatttgcgaaacgatcgtgtggaaggcgttctcgccggcgact
gtcaacaccggacgaggaaccgagtttgagggtgcggttattgcgctgttccatctgttg
gccacccgccaggacaaggttcgcggtctgcgcgaagctttctaccgccagaacctgccc
aatctgatgaacctgctggcgaccgtgctcgtgtttgcggtggtgatatacttccagggc
ttccgcgtggatctaccgatcaagtcggctcgctaccgtggccagtacagcagctacccg
atcaaactgttctacacctcgaatatcccgatcattctgcaatccgcgctcgtctctaac
ctgtacgtcatctcgcaaatgttggccgtcaagttccacggcaacttcctgatcaacctg
ctcggcgtgtgggccgacgttggaggtggcggcccagcccgttcctacccgatcggtggt
ctgtgctactatctgtccccacctgaatccctcggccacatcgtgtctgatccgatccac
gccgtgctgtacatcatcttcatgctcggctcgtgcgcgttcttctccaagacctggatc
gacgtgtcgggcagctcggccaaggacgtcgccaagcagctcaaggagcagcagatggtg
atgcgtggccaccgggaaaactccatgatccacgagctgaaccggtacatcccgacggcg
gccgccttcggaggactctgcatcggtgcgctgtccgtgctggccgactttatgggtgcg
atcgggtccggaaccggtatcctgctcgccgtcaccatcatctaccagtactttgagatc
ttcttgaaggagcagagcgaaatgggcggcatgggaacgttactcttctag

DBGET integrated database retrieval system