KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007795Help
Entry
CpipJ_CPIJ007795  CDS       T01079                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00230  Purine metabolism
cqu01100  Metabolic pathways
Module
cqu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CpipJ_CPIJ007795
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CpipJ_CPIJ007795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA_18 AAA_16 ABC_tran Septin RsgA_GTPase RNA_helicase ATPase_2 Rad17 AAA_29 MMR_HSR1 AAA_14 NACHT cobW AAA_23 Pox_A32 NTPase_1 AAA_17 AAA AAA_21 AAA_24 NB-ARC AAA_28 MobB T2SSE AAA_5 G-alpha AAA_30 FtsK_SpoIIIE Viral_helicase1 Roc
Motif
Other DBs
NCBI-GeneID: 6039629
NCBI-ProteinID: XP_001849204
VectorBase: CPIJ007795
UniProt: B0WKH0
AA seq 212 aa AA seqDB search
MVKQGPRPLVICGPSGSGKSTLLKKLFKEFPDTFGFSVSHTTRKPRPGEENAVHYHFVSV
EEMQAAIENGEFIETAVFSGNMYGTSKQAVENVQHQGKVCVLDIEIEGVKQVRNSDRLNP
LLVFINPPSVAELERRLRGRQTETEESLQKRLNTARVEIEYGTTTGNFDVVIHNNNLKQA
YADLRDFIVRELETQQGQGINVSLNRVPLADD
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggttaagcaaggtccacgcccactggtcatctgtggcccatcgggatccggaaagagc
accctactgaagaagctcttcaaggagttcccggacacgttcgggttcagtgtgtcgcac
acgacgcggaaaccccgaccgggtgaggaaaacgcagtccactaccactttgtgtccgtc
gaggaaatgcaggccgccatcgagaatggggagttcattgaaacggccgtgttcagcggg
aacatgtacggaacgagcaaacaagcggtggaaaacgtgcaacaccagggcaaggtgtgc
gtgctggacatcgagatcgagggggtgaagcaggtgcgcaactcggaccgcctgaaccca
ctgctggtgttcatcaacccgccgtcggtggccgagctggagcggcggttaaggggccgc
cagacggaaaccgaggagagcctgcagaagcggctcaacacggcgcgcgtcgagattgag
tatggcaccaccacgggcaacttcgacgtcgtcatccacaacaacaacctgaagcaggcg
tacgccgacctgcgggactttatcgtgcgcgagctcgagacccagcagggccaaggtatc
aacgttagcctgaaccgcgtgccgcttgccgacgactaa

DBGET integrated database retrieval system