KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008211
Entry
CpipJ_CPIJ008211  CDS       T01079                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
SSDB
Motif
Pfam: JHBP
Other DBs
NCBI-ProteinID: EDS30250
VectorBase: CPIJ008211
UniProt: B0WL77
AA seq 243 aa
MELLLCVVFLVSTLSTGFAQVLPPTFQLCHRSDPKFDKCLSEAITGALRAMKNGIPEFGI
LPINPLAISALSIQQGASSPINLKQDFKNLKLTHLADSVVTRSKTDLDKFVLRSEAVTPY
MEIFGDYTMEGRVLLLPVTGRGFANITLHGLKTKHELIGEPIQQNGETFMRIKKYNVKLE
EPKHMTIFFGNLFNGDVALGNAMNGVMNDNWQLMFRELRGAFEDTFGYIFKDISNKLFLK
CCS
NT seq 732 nt   +upstreamnt  +downstreamnt
atggaactgttgctgtgcgtcgtttttctagtttcaactttgtcaaccggttttgcacaa
gttctgcctccaacattccaactgtgccaccggagcgatcccaagtttgacaaatgcctc
tcggaagcgatcaccggtgcccttcgtgcaatgaaaaacggaattccggagtttggcatt
cttcccatcaatccgctggccatttcggcgctctccatccagcaaggagcatcgtccccg
attaatctgaaacaggatttcaaaaatctaaaactaacccacctggcagattcggttgta
acgcgatcaaagactgacttggacaaatttgtgctgcgttctgaagccgttacgccgtac
atggaaatttttggggattatacgatggaaggacgagtgcttctgttacccgtgactgga
cgaggattcgcgaatataactctgcatggattaaaaacaaaacacgagctaatcggtgag
ccaattcaacaaaatggtgaaacctttatgcgtataaagaagtacaatgtgaagctggaa
gaacctaagcatatgacgattttctttggaaatttgttcaacggagatgttgcgttgggt
aatgcaatgaacggagtcatgaacgataactggcaattgatgtttagagagctgcgtggt
gcatttgaggacactttcggttacatatttaaggacatcagcaataaacttttccttaag
tgctgcagttaa

DBGET integrated database retrieval system