KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008287
Entry
CpipJ_CPIJ008287  CDS       T01079                                 
Name
(GenBank) phosphoserine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00260  Glycine, serine and threonine metabolism
cqu00270  Cysteine and methionine metabolism
cqu00750  Vitamin B6 metabolism
cqu01100  Metabolic pathways
cqu01200  Carbon metabolism
cqu01230  Biosynthesis of amino acids
cqu01240  Biosynthesis of cofactors
Module
cqu_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpipJ_CPIJ008287
   00270 Cysteine and methionine metabolism
    CpipJ_CPIJ008287
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CpipJ_CPIJ008287
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cqu01007]
    CpipJ_CPIJ008287
Enzymes [BR:cqu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     CpipJ_CPIJ008287
Amino acid related enzymes [BR:cqu01007]
 Aminotransferase (transaminase)
  Class V
   CpipJ_CPIJ008287
SSDB
Motif
Pfam: Aminotran_5 PH_12
Other DBs
NCBI-ProteinID: EDS30182
VectorBase: CPIJ008287
UniProt: B0WL19
AA seq 362 aa
MVINFGAGPAKLPREVLLEVQKELVEYGSSGMSVMEMSHRGATYVKLHNETIELARELLK
VPDNYKVLLMQGGGTGLFAAVAMNLIGRTGSADYLVTGSWSSKAAKEAAKYGKVNQVVPK
AAKCTCVPDPKTWKLDPNASYLYYCDNETIEGVEFDFVPETNGVPLVVDMSSNMMSRPVD
IKKFGVIFACAQKNIGPSGITLVIVREDLIGHQMPITPTILDFSIVAKDNSINNTPPTLI
IYIMGRVFAWIKRQGGLDKLYQASLTKSALIYDVIAASKDFYYCPVESKVRSRMNVPFRV
GGAEGNETLEKEFLKGAEALGMQQLKGHRLVGGIRASLYNAVTIEEAEALRKYMVEFRAK
NA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggtgatcaattttggagctggccctgccaaattacctcgggaggttctgctcgaggtc
cagaaggagctcgttgagtacggatcgagcgggatgagcgttatggaaatgtcccatcga
ggggcgacgtacgtgaaactgcacaacgaaacgatcgagctggcgagggaacttctgaag
gttcccgacaactacaaagtgctgttgatgcaaggcggtggtacgggactgtttgccgca
gtcgccatgaacttgattgggcgtacgggttcggcagactacctggtgaccggttcatgg
tcctcgaaggccgccaaggaagcagcgaaatacggcaaggtgaaccaggtggtaccgaag
gccgccaaatgcacgtgcgttcccgatccgaagacctggaagctggacccgaacgcgtcc
tacctgtactactgcgacaacgaaacaatcgaaggtgtcgagtttgactttgtgccggag
accaacggtgttccgctggtggtggacatgtcttcgaacatgatgtcgcgacccgttgat
atcaagaagttcggagtgatatttgcttgtgcccagaagaacattggtccatcgggtatc
acgctggtaatcgttcgggaagacttgatcggccatcagatgccgatcactcctacgatt
ctggatttttcgatcgtcgccaaggacaattccatcaacaacaccccaccaactctcatt
atctacatcatgggtcgcgtcttcgcgtggatcaagcgccaaggtggactggacaaactg
taccaggcatccctcaccaaatccgccctgatctacgacgtgatcgccgcttcaaaggac
ttctactactgcccagtggagagcaaagtgcgcagccgaatgaacgtgccgttccgtgtg
ggaggcgccgagggcaacgagacgctcgagaaagagttcctgaagggcgctgaagcgcta
gggatgcaacagctcaagggtcatcgactggtcggcggtattcgagcctccctgtacaac
gccgttaccatcgaggaagccgaagctctgcggaagtacatggtggagtttcgcgccaaa
aatgcctaa

DBGET integrated database retrieval system