KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009107
Entry
CpipJ_CPIJ009107  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ009107
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqu04147]
    CpipJ_CPIJ009107
   04090 CD molecules [BR:cqu04090]
    CpipJ_CPIJ009107
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CpipJ_CPIJ009107
Peptidases and inhibitors [BR:cqu01002]
 Metallo peptidases
  Family M2
   CpipJ_CPIJ009107
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ009107
CD molecules [BR:cqu04090]
 Proteins
  CpipJ_CPIJ009107
SSDB
Motif
Pfam: Peptidase_M2
Other DBs
NCBI-ProteinID: EDS33274
VectorBase: CPIJ009107
UniProt: B0WR90
AA seq 621 aa
MVTKVLVLALLASVALAVNPDLEDQELAGQKYVSDLEADILARNNEATEASWAYESDISE
AHLKARDEIQVRNANYFKEVARELRKYDWQNFKNGDLKRMFKKMTDLGYAALPEAKFTEL
LDAISSMSENYATAKVCDYKNREKCDLALEPELTEIFATSRDPEELKYYWTQWYDKAGTP
TREAFDKYIKLSNEAAKLNNLSSGAEAWLDAYEDETFEQQADAAIEQIRPLYEQIHAYVR
HKLRERYGEDVVSEKGPIPMHLLGNMWAQSWDNVADFTTPYPNSQLMDVTEEMVKQGYSA
KQMFEMGDDFFVSLNMTRLPQSFWEKSILEKPTDGRELVCHASAWDFYKTDDVRIKQCTR
INMEDFFTAHHELGHIQYFLQYQHQPSTYREGANPGFHEAVGDVISLSVSTPKHLEKIGL
LKDFVMDEEAKMNQFYRQGLSKLVFLPFAYTLDKYRYGMFRGEIKPDQANCKFWEMRTKF
SGIEPPVVRSEKDFDGPAKYHMSADVEYLRYLVSFIIQFQFHRSACELAGEYVKGDPVKT
LNNCDIYQNANAGNAIKEMLALGSSKPWPDAMEVLTGQRTMSADALLEYFQPLQDWLVVE
NKRLGAYVGWEKSDKTLLLDR
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggtgacaaaagtgctcgtgttggccctgctggccagcgtagccctcgcggtgaatccc
gacctcgaggaccaggagctggcgggtcaaaagtacgtcagcgatctggaggcggacatc
ctggcccggaacaacgaagccacggaagcgtcctgggcgtacgagtcggacatcagcgag
gctcacctgaaggcccgggacgagatccaagttcgcaacgcaaactacttcaaggaggtt
gcccgcgagctgcgcaagtacgactggcagaacttcaagaatggcgacctgaagcggatg
ttcaagaagatgaccgacctcggctacgctgctctgccggaggccaagttcaccgagcta
ctggacgccatctccagcatgtcggagaactatgccacggccaaggtgtgcgactacaag
aaccgcgagaagtgcgacctggcgctcgaaccggaactgacggagatcttcgcgacaagc
cgtgacccggaagagctcaagtactactggacgcagtggtacgacaaggctggaacccca
acccgggaagcgttcgacaagtacatcaagctgagcaacgaagcggccaagttgaacaat
ctctcatccggtgcggaagcctggctggacgcgtacgaggacgaaaccttcgagcagcaa
gcggacgccgccattgagcagatccgtcccctgtacgagcagatccacgcgtacgtccgg
cacaagttgcgcgagcgttacggtgaggatgtcgtttcggaaaagggacccattccgatg
cacctgctgggaaatatgtgggcccagtcgtgggataacgtggcggactttacgacgccg
taccccaacagtcagctgatggatgttacggaggagatggtaaaacagggttattccgca
aagcagatgttcgagatgggggatgacttcttcgtgtcgctgaatatgactcggctgccg
cagtccttctgggagaagagcatcctggagaagcccaccgacggtcgcgagctggtgtgc
cacgccagcgcctgggacttttacaagaccgatgacgtacgcatcaagcagtgcacgcgc
atcaacatggaggatttcttcacggcgcaccatgagctgggccacatccagtacttcctg
cagtaccagcaccagccgtcgacctaccgcgagggtgcgaaccccggtttccacgaggcc
gtcggagacgtcatttcgctgtccgtttccacgccgaagcacttggagaagatcggactc
ctcaaggatttcgtcatggacgaggaagccaagatgaaccagttctaccgccagggtctg
tccaagttggtgttcctgccgttcgcctacacgcttgacaagtaccgttacggtatgttc
cgaggggaaatcaagcccgaccaggccaactgcaagttctgggagatgcgcaccaagttc
tccggcattgaaccgccggttgtccgcagcgagaaggactttgacgggcccgccaagtac
cacatgtccgcggacgtggaatatctgcgctacctggtgtccttcatcatccagttccag
ttccaccggtcggcgtgcgaactggccggcgagtacgtcaagggggatcctgtgaagacg
ctgaacaactgtgacatctaccagaacgcgaacgctggcaatgccatcaaggagatgctc
gcgttgggatcttcgaagccgtggccggacgcgatggaggtgctgaccgggcagcgcacg
atgagtgccgacgcgttgctcgagtacttccagccgctgcaggattggctggtggtggaa
aacaagcggctgggtgcttacgtcggatgggagaagtcggacaaaacattgttattagac
agatag

DBGET integrated database retrieval system