KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009391Help
Entry
CpipJ_CPIJ009391  CDS       T01079                                 

Definition
(RefSeq) hypothetical protein
  KO
K20030  palmitoyltransferase ZDHHC5/8 [EC:2.3.1.225]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cqu04131]
    CpipJ_CPIJ009391
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     CpipJ_CPIJ009391
Membrane trafficking [BR:cqu04131]
 Protein recycling
  Others
   GRIP associated proteins
    CpipJ_CPIJ009391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC MFS_2
Motif
Other DBs
NCBI-GeneID: 6041767
NCBI-ProteinID: XP_001850985
VectorBase: CPIJ009391
UniProt: B0WQK1
AA seq 806 aa AA seqDB search
MGHDFGRSAASSSSSSSSSCRQFYVQRHPWVPAYQAVITFFVIANFTMATFMDPGVIPKA
PPDEDREDEFRAPLYKNAEINGITVRMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPW
VNNCIGRRNYRFFFFFLISLSIHMLSIFSLSLIYVLQKEKDKLTEVEPIVAMILMAIVTL
LAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWNNCCYTQCGPQYPSLLKP
QKYVARRSNKENQSISTITNDGGPGGGGSGNGSGRHLNSQQQALNPGGSGGGGQGIYDNS
RHTQVKTYMDHGNGHGIRTVGSSHYSKLSPGRDGSDIDMEPQGTQSRDCEPTPPLQRHGS
KSNFFLPPMDGNGGMNMNGGQGGAQGGQNGGGDSPRQHIRMYHPRHSPHPRQRGLDPSRS
FTPEGLSPDQQQPPPPMITIQQQQQNQQGMPRGGNNSSATPTMQQRIKALGVATPLAMSS
PVRRSNPGTPTQPRRPDFIGVNMMSPQQQQQLQQQQQQQQFHQTGLPPVHPYHQQQQQQQ
SQQLQQQYPMVHHNGGLPGQQQQQPGQVRPPSNVVVSAQRRYLSEGELARQGAELSYARS
NQTVDNIRELAGSPQRGVYMWKNDTSPGFSNGVGVVNPQLSQAQQPGPGVFVSMAQSAAA
GVYQNQPSPTTAPQQSSSYGGVSAARYQLQQAQQSQTAAAAAGYHPALRGGVPVFPPQPP
IVTTTAQSIGGPQAPSPQIKRKATPTRPMSFVRALEMTDSLEMNPTGQAQGGQDGSSQQG
GAGGRATTPTPPDRASVYDMNYEISV
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgggacatgactttggtcggtccgccgcctcatcatcctcgtcctcgtcctcgtcatgt
cgccagttctacgtccagcggcacccatgggttccggcgtaccaggccgtcatcacgttc
ttcgtcatcgccaacttcacgatggccaccttcatggatcccggcgtcataccgaaagcc
ccgcccgacgaggaccgcgaggacgagttccgggcgccgctgtacaagaacgccgaaatc
aacggcatcacggtgcgcatgaagtggtgcgtcacgtgcaagttctaccggccgccccgg
tgctcgcactgttccgtctgcaatcactgcattgagacgtttgaccaccactgcccgtgg
gtgaacaactgcatcggccggcggaactatcgctttttcttcttcttcctgatctcgctg
tcgatccacatgctgagcatcttctcgctgtcgctgatctacgtgctccagaaggagaag
gacaagctgaccgaggtggaaccgatcgtggccatgatcctgatggccatcgtgacgctg
ctggcgatcccgatcttcggcctgaccgggttccacatggtgctggtgtcgcgggggcgc
accaccaacgagcaggtcaccggcaagttcaagggtggctacaatccgttctcgcggggc
tgctggaacaactgctgctacacccagtgcggtccgcagtacccgagtctgctgaagccg
caaaagtacgttgcccggcggtccaacaaggagaaccaatcgatcagtacgatcacgaac
gacgggggcccgggtggtggcggcagtggcaacggctccggccgccatctcaactcgcag
cagcaagcgctgaacccgggaggctccggtggcggcggccagggcatctatgataatagt
cgccacacgcaggtaaaaacctatatggaccatggcaatggtcacggtattcgtacggtc
ggatccagccactacagcaagctatcgccgggtcgggacgggtccgacattgacatggaa
ccgcagggcacccagagccgggactgcgagccgacgccgccgctgcagcggcacggttcc
aagagtaacttcttcctgcctccgatggacggcaacgggggcatgaacatgaacggcggc
cagggaggagctcagggtggccaaaacgggggcggagattccccgcggcagcacatccgg
atgtatcacccgcggcacagtccccatccgcgccaacgtgggctcgatccgtcgcggagc
tttacgccggagggactttcgccggatcagcagcaacctccgccgccgatgattacgatc
cagcagcagcagcaaaaccagcaaggaatgccacgtggaggaaataattcgtcggccacg
cctactatgcagcagagaatcaaagcgcttggcgtcgcgacgccactggccatgtctagt
cctgtgaggaggtccaaccccggaacgccaacccagccccggcggcccgactttatcggc
gtcaacatgatgagcccgcagcaacagcagcaactccaacaacaacagcagcagcaacaa
ttccaccaaaccggtcttcccccagtgcatccgtaccatcagcaacagcagcagcaacaa
tcgcaacaacttcagcagcaatatccgatggtccaccataacggtggcctgcccggccag
cagcagcagcaaccgggccaggttcgacccccctcgaacgtggtcgtgtccgcccagcgc
cggtacctctccgagggcgaactggcccggcagggcgccgagctgtcgtacgcgcgcagc
aaccaaaccgtggacaacatccgcgagctggccggcagtccgcagcggggcgtgtacatg
tggaagaacgacacctcgcccggcttcagcaacggcgtcggcgtcgtcaatccgcagttg
agtcaggcgcagcagcccggtcccggcgtctttgtgagtatggcccaatccgccgccgcc
ggggtgtaccagaatcagccgagcccgacgacggcacctcagcagagcagcagctacggc
ggagtcagtgccgcccggtaccagcttcagcaggcgcaacagtcccaaacggcggcggcc
gcagcggggtaccatccggcgttacgagggggcgttccggtgttcccgccgcaacctccc
atcgtaacgacgacggcccagtcgatcggaggcccgcaggcgccctccccccagatcaag
cggaaagccaccccaacgcggccaatgtcctttgtgagggcgctcgagatgaccgattcg
ctggagatgaacccgacggggcaggcccaaggtggacaagatggaagtagtcagcaggga
ggagccgggggacgagcgacgacgccgacgccgccggatcgggccagcgtgtacgacatg
aactacgagatttccgtataa

DBGET integrated database retrieval system