KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010401Help
Entry
CpipJ_CPIJ010401  CDS       T01079                                 

Definition
(RefSeq) phosphatase 1 regulatory subunit 7
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cqu01009]
    CpipJ_CPIJ010401
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CpipJ_CPIJ010401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8
Motif
Other DBs
NCBI-GeneID: 6043297
NCBI-ProteinID: XP_001858337
VectorBase: CPIJ010401
UniProt: B0WUA8
AA seq 321 aa AA seqDB search
MSDNNEEERPETPEEAQPEPKPDEEPPAKMEDVITIDPEATELDLNHGRVGKIEQLEPLV
NLERLYMRWNLIKKIENLDHLTELQELELYDNQITELENLNCLVNLEMLDVSFNRLHKIQ
NLEELTKLRKLFLCANKISTIENVGHLSNLTMLELGDNKIRKIQNLESLTNLTHLYLGKN
KINKIENLDQLVKLECLSLQSNRIVKLENLDKLVNLTELYISENGIERIENLAENKALET
LDLAKNRVKVLENLDHLACLEELWMNDNAVSDWNCVTVLAQNKKLATVYLERNPLAGDVT
YRNKLKLAVPWLTKIDATLCR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataataatgaggaggagcgcccggaaactcccgaagaggcgcaaccggaaccg
aagccggacgaggagccgccggcaaagatggaggacgtgataacgatcgacccggaagcg
accgaactggacctgaaccatgggcgcgttgggaagatcgagcagctggaaccgctggtc
aatttggagaggttgtacatgcgctggaatttgatcaagaaaattgagaatttggaccat
ctgacggagctgcaggagctggagttgtacgacaatcagatcaccgagctggagaacttg
aattgtctggttaatttggaaatgctagacgtaagctttaatcgattgcacaaaattcag
aatctggaagagctgacaaagctgcgcaagctgtttctgtgcgcgaataaaatctcaacc
atcgaaaatgttggccacctaagtaatttgaccatgctcgagcttggagacaataagatt
aggaaaatccagaacctcgagtcgctcacgaacctaactcatctttatcttggtaaaaac
aagatcaacaaaatcgaaaatctggaccagctcgtgaagctggaatgcctcagcttgcag
agcaaccggattgtgaagctggaaaacctggacaagttggtgaacctcacagaactgtac
atatcggagaacggcatcgagcgaattgaaaacctcgccgagaacaaagcgctggagacg
ctcgatttggccaaaaatcgcgtcaaggtgctggagaatttggaccatttggcgtgtctg
gaagagctttggatgaacgacaacgcggtctccgactggaactgcgtgaccgtcctggcg
cagaacaaaaagctcgcaacggtttatctggagcggaatccactcgccggggatgtcacc
taccggaacaagctgaagctggcggttccctggctgaccaagatcgatgccacgctgtgc
cgttga

DBGET integrated database retrieval system