KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010472
Entry
CpipJ_CPIJ010472  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K08504  blocked early in transport 1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    CpipJ_CPIJ010472
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cqu04131]
    CpipJ_CPIJ010472
Membrane trafficking [BR:cqu04131]
 SNARE
  SNAP-25[C] (Qc)
   Bet1
    CpipJ_CPIJ010472
SSDB
Other DBs
NCBI-ProteinID: EDS34472
VectorBase: CPIJ010472
UniProt: B0WTL9
AA seq 121 aa
MRRSQGYAYQPLGQNPGPSGSGGAHSSHDALEEENERMADELKGKIGALKSLTIDIGNEV
RYQDKLLRGIDEDMDRTGGFMSNTISRVVRLGKGGHRNYMCYMFLFVMFVFFILFLILKL
R
NT seq 366 nt   +upstreamnt  +downstreamnt
atgcgacgttcccagggctatgcgtaccagccgttgggccaaaacccgggcccgagtggc
agcggtggagcccacagcagtcacgacgccctggaggaggaaaacgaacggatggcggac
gagctgaagggcaagatcggggcgctcaaatcactcacgatagacatcgggaacgaggtc
cggtaccaggacaagctgctgcggggcatcgacgaggacatggaccggaccggggggttt
atgagtaatacgatttcgcgcgtcgttcggctggggaagggtggccacaggaattacatg
tgctacatgtttctgtttgtgatgtttgtgttctttattctgtttttgatattgaagctc
agataa

DBGET integrated database retrieval system