KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011249Help
Entry
CpipJ_CPIJ011249  CDS       T01079                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00010  Glycolysis / Gluconeogenesis
cqu00562  Inositol phosphate metabolism
cqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpipJ_CPIJ011249
   00562 Inositol phosphate metabolism
    CpipJ_CPIJ011249
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     CpipJ_CPIJ011249
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     CpipJ_CPIJ011249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 6044411
NCBI-ProteinID: XP_001861931
VectorBase: CPIJ011249
UniProt: B0WX09
AA seq 482 aa AA seqDB search
MSHVIVVVLIGVRILSVTATSADEAYCYSLDENRTQWGHFATRTAYEVVRDSSSSRNYFE
ADCIPTKYWLLVRHGTRLHGTKYINFLPRSLNKLRDAILANNDSRKVICSDDLALLRHWR
WDSNMTTDYEGFLTESGWNELKNLATREKTRFGALFHGPYRKDRFHFRYTNTQRTVASFR
AFAEGLFGDGAYARVYAEGEPTRDTLLKPHFFCPDYDENKSKIRGPGSEQDKFMQSALFQ
QTIADISTRLGFPYNLTLDQIEDMWDHCRFEQAWYLPQLSPWCSVFTKEQINVLEYKEDL
RYYYQSGHGYARAGDLACFTMADMMRHLGQAGGEPSIIAYFCHESIIQLFLVALGAKKDP
NPLRSDNYEAMRNRQFRSSEWTPFAANVAAVRYQCNDVVSPVKIKFFLNEKVLMFDWCER
GSCDWDEVQRSPGRLPESCLGGVTDRQLESQSKGRQCESRGGWKLRCKKRFGLSHRFKPS
ET
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgtgatcgtagttgtcctgattggtgttcggatactgtctgttactgctact
agtgccgacgaagcatactgctacagtctggatgagaaccgaactcaatggggtcatttc
gcgaccagaaccgcctacgaggtcgtccgggattcgtcctcaagccggaattattttgaa
gctgactgcatccccaccaagtactggctgttggtccgtcacggaaccagacttcacggt
accaagtacatcaacttcttgcctcggagtttgaacaaacttcgagacgcaattctcgcc
aacaacgacagtcgcaaggtgatatgctcggacgatctggcactgctgcgacactggcgc
tgggacagcaacatgaccacggactacgagggctttctcacggaaagcggttggaacgag
ctgaaaaatttggccacgcgcgagaagactcgtttcggcgcactgttccacggtccctat
cggaaagatcgcttccacttccggtacaccaacactcagcgaaccgttgccagcttccgg
gcgtttgccgaaggtctgtttggggatggtgcgtacgcgcgggtctatgcggaaggagaa
cccacacgggacactttgctgaaaccgcactttttctgtccggattacgatgagaacaag
agcaagatccggggaccgggctcggagcaggacaaattcatgcaatcggcactgtttcag
cagaccatcgcggacatttccacccgattgggcttcccgtacaacctgaccctagaccag
atcgaagacatgtgggaccattgcaggttcgaacaggcttggtaccttccccaattgagt
ccgtggtgttcggtcttcaccaaggagcagatcaacgtgctcgagtacaaggaagacctg
cggtattactaccagagcggccacgggtacgcccgggctggtgacctagcgtgcttcacg
atggccgacatgatgcggcacttggggcaggccggtggcgaaccgtcaatcatcgcgtac
ttttgccacgagtcgatcattcagctgttcctggttgcgttgggggctaaaaaagatccc
aacccgctgcgatcggacaactacgaagccatgcgaaaccgacagtttcggagcagcgag
tggacaccatttgcggccaatgtggctgccgtgcggtaccagtgtaacgacgttgtgagt
ccggtgaagatcaagttctttctgaacgagaaggtgctgatgtttgattggtgtgagcga
ggttcgtgcgattgggatgaggttcagcggagtccaggtcgtctccctgagtcctgcctc
ggtggagtcactgataggcagttggagtcacaatccaaaggtcgtcagtgcgaatcccgg
ggtggatggaagctcaggtgcaaaaagaggttcggattgtctcaccgtttcaagccttcg
gagacctag

DBGET integrated database retrieval system