KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011263Help
Entry
CpipJ_CPIJ011263  CDS       T01079                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CpipJ_CPIJ011263
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cqu03041]
    CpipJ_CPIJ011263
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CpipJ_CPIJ011263
Spliceosome [BR:cqu03041]
 Complex C
  Other components
   Step II factors
    CpipJ_CPIJ011263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 6043961
NCBI-ProteinID: XP_001861545
VectorBase: CPIJ011263
UniProt: B0WVX3
AA seq 1253 aa AA seqDB search
MDELEQLEHLSLVSKICTELENHLGLNDKDLAEFIIDLAEKNPSEEGFRRVLGENGAEFS
ESFTANLLRIIQLMKPPKNRPGGGGAADFERDDQVGALACKFPGLAIPNAKKGYESEPED
GEEFESKKRTNVVDDMFAELESMAPSTSKGGGSKKSREQQEVDNMLAELESLAPSTSSTG
KREDREGGRLDRRSRSKDRKRSRSRERKRSRSRDRDRERRRRSRSRDKERRRRSRSGERD
RRSRRSRSRSRDRRRHRSRSREFEQRKRTPPRQMPEEPEPGQIYNGRVVNIVAFGCFVQL
TDFRRKKEGLVHISQLSSEGRVNTVTDVVNRNDNVKVKVISIAGSKISLCMKDVDQESGK
DLNPLSHAHLQDGEMANRNPDRPMNVPSMLNIQENDGAEETSHKKVTRISSPERWEIKQM
ISSGVIDRSEMPDFDEETGLLPKDEDSEADIEIEIVEDEPPFLQGHGRALHDLSPVRIVK
NPDGSLAQAAMMQSALAKERREVKMLQREQEMDSVPTNMNKNWIDPLPEEDTRALAANVR
GVGMAMADVPEWKKAIIGGKKSSYGKKTDMSLVEQRQSLPIYKLRDDLIKAVTDNQILIV
IGETGSGKTTQITQYLAECGFIARGKIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTI
RFEDCTSQETVIKYMTDGMLLRECLVDFDLKSYSVIMLDEAHERTIHTDVLFGLLKQAVQ
KRPELKLIVTSATLDAVKFSQYFFEAPIFTIPGRTFPVEILYTKEPETDYLDASLITVGY
YCGNYDAKLSSYLFQVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELI
ILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSK
TGMDSLVVTPISQAAAKQRAGRAGRTGPGKAYRLYTERAYRDEMLPTPVPEIQRTNLATT
VLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDNEGLLTRLGRRMAEFPLEPN
LSKLLIMSVALNCSDEVLTIVSMISVQNVFYRPKDKQALADQKKAKFNQIEGDHLTLLAV
YNSWKNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKSTMRVQKAIC
SGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVVYHELVQTTKEYMREVTTI
DPKWLVEFAPAFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRTRRRRN
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atggacgaactggaacagctcgagcacctgtcgctggtgtccaagatctgcacggaactg
gaaaaccacttgggcctaaacgacaaagatttggccgagttcatcatcgatcttgcggag
aaaaacccctccgaagagggcttccgccgcgtgctgggcgaaaacggtgccgagttttcc
gaatcgttcaccgcgaacctgctgcgcatcatccagctgatgaagccgcccaagaatcgg
ccaggcggtggtggcgcggccgatttcgagcgggacgatcaggtgggcgcgttggcgtgc
aagtttccggggctggccatcccgaacgccaagaaggggtacgagtcggaaccggaggat
ggggaggagttcgagtcgaagaagcgaacgaacgtggtggatgatatgtttgcggagttg
gagagtatggcgccgtcgacgtcgaagggtggtgggagtaagaagtcgagggagcagcag
gaagtggacaacatgctggcggagttggagagtttggcgccgtcgacttcgtcgactggg
aagagggaggatcgtgaggggggaaggctggaccgacggagtagatccaaggacaggaag
aggagtaggtcgagggagcggaagcggagtaggtcgcgggatagggatagggagcggagg
aggaggtcgcggtcaagggataaggagcgaaggaggaggagcaggagtggggagagagat
cgtaggtcgcgtcgtagtcgtagccgttcgagggatcggagaaggcaccgcagcaggtcg
agggagtttgagcagagaaagcggacgccgccgcggcagatgccggaagaaccggagccc
ggtcaaatctacaacggtagggtggtcaacattgtggcgtttggttgcttcgttcagttg
acggactttcgccgcaagaaggaaggattggtgcacatttcgcagctttcgtccgagggt
cgggtgaacaccgtgacggatgtggtcaatcggaacgacaacgtcaaggtgaaggtgatt
tcgattgccggctcaaagatatcgctctgtatgaaggacgttgatcaggaatcgggcaag
gatttgaatccgctgtcgcacgcgcacctgcaggacggtgaaatggccaaccggaacccg
gatcgaccgatgaacgtaccgtcgatgctgaacatccaggagaatgatggcgcagaggag
acatctcacaagaaggtgacgcgcatctccagtccggaacgttgggagatcaagcagatg
atttcatccggcgtgattgaccgcagcgagatgccagatttcgacgaggaaacggggttg
ctgccgaaggacgaagacagcgaggcggatattgagattgaaattgtggaggatgaacca
ccgtttttgcagggtcacggtcgtgcgttgcacgatctttctccggtgagaatcgtcaag
aatccggacggatcgctggcgcaggccgcgatgatgcaatccgcgctggcgaaggaacgt
cgtgaagtgaagatgcttcagcgggagcaggaaatggactcggtcccaacgaacatgaac
aaaaactggatcgatccgttgcccgaggaagatacgagagcgctggcggcgaatgtccga
ggcgtcggtatggccatggcggacgtccccgagtggaagaaggccatcatcggtggcaaa
aagtcctcgtacggcaagaaaaccgacatgagtctggtcgagcagcggcagtcgttgccg
atctacaagctgcgcgacgatctgatcaaggccgtcacggacaatcaaattctgatcgtc
atcggtgaaaccggttccggcaagacaacccaaatcacgcaatatctggccgagtgtggc
ttcatcgcgcgtggcaagatcgggtgcacccagccgcgtcgtgtggccgccatgtccgtg
gcgaagcgcgtggcggaagagtacggttgtcggctcgggcaggaggtcggctatacgatc
cgtttcgaggactgcacctcgcaggaaacggtcatcaagtacatgacggacggtatgttg
ctgcgcgagtgcttggtcgatttcgacttgaagtcctactccgtgatcatgttggacgag
gcgcacgagcggaccattcacacggacgttctgtttgggttgctcaagcaggcggtccag
aagcggccggaactcaagctgatcgttacttcggccacgctggatgccgtcaagttttcg
cagtactttttcgaggctcccatttttaccattccgggtcgaaccttcccggtggagatt
ctgtacaccaaggaaccggaaacggactatctggacgcgtcgttgatcacggtaggttac
tattgtggcaattacgacgccaagctaagttcatatctctttcaggttatgcaaatccac
cttcgagaaccacccggcgatattctgctcttcctcacgggtcaagaagagatcgacacg
gcttgcgagatcctgtacgaacgtatgaaatcgctcggaccggacgttccagaactcatc
atcctccccgtctactccgccctgccctcggaaatgcaaacccgtatcttcgatccggcc
ccgcccggctcccgcaaagtggtcatcgcgaccaacatcgccgaaacttcgctcaccatc
gacggaatttactacgttgttgacccgggcttcgtaaagcaaaaggtttacaactccaaa
acgggcatggactcgctggtcgtaacccccatttcgcaagctgccgccaagcagcgcgcc
ggtagagctggacgaaccggtcccggaaaggcgtaccgactgtacacggagcgagcgtac
cgggacgaaatgttgcccacccccgtgccggaaattcaacgcaccaacttggccaccacg
gtgctgcagctcaaaacgatgggcatcaacgacctgctgcactttgactttatggacgcc
ccaccggtagaatcgctcgtaatggccctggaacagctgcactcactctcggcgctggac
aacgaaggtctgctgacgcggctgggtcgtcgaatggccgagttccccctcgaaccgaac
ctctccaagctgctcatcatgagcgttgcgctcaactgctccgacgaagtcctgaccatc
gtttcgatgatctccgtgcagaacgtgttctatcgccccaaggacaagcaagccctcgcc
gatcagaagaaggccaaattcaaccagatcgagggagatcacctcaccctgcttgccgtg
tacaacagctggaagaacaacaaattctcaaacgcctggtgctacgaaaactttgtccaa
atccgtaccctcaaacgagcccaggacgtgcgcaagcagctgctcggcatcatggaccgt
cacaagctggacgtggtttccgccggcaagagcaccatgcgcgtccaaaaggccatctgc
tccggcttcttccgaaacgcggccaaaaaggacccccaggaaggctaccgcacgctggta
gactcccaggtcgtctacattcacccgtcgagcgccctcttcaaccggcaacccgagtgg
gtcgtctaccacgagctggtccaaaccaccaaggagtacatgcgcgaagtgaccaccatc
gaccccaagtggctcgttgagttcgcgcccgccttctttcgcttctccgaccccaccaag
ctcagcaagttcaagaagaaccaacggctggaaccactctacaacaagtacgaagaaccg
aacgcgtggcgaatcagccgaacccgacgacgacggaactaa

DBGET integrated database retrieval system