KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011452
Entry
CpipJ_CPIJ011452  CDS       T01079                                 

Definition
(RefSeq) ku P80 DNA helicase
  KO
K10885  ATP-dependent DNA helicase 2 subunit 2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CpipJ_CPIJ011452
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ011452
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     CpipJ_CPIJ011452
SSDB
Motif
Pfam: Ku Ku_PK_bind Ku_N Ku_C
Other DBs
NCBI-GeneID: 6043914
NCBI-ProteinID: XP_001861497
VectorBase: CPIJ011452
UniProt: B0WVS5
AA seq 722 aa
MARTKEACILILDVGKDTLVKSGKNDLTFFERAKGCVTKIVQRKIFSKPHDEVGLVLMGT
DDTSNQLNVECGGYEHIAEAFELGPSNWKMLRILESRIQPSKVNANWFDALLVATNFLKV
GAQAKKFATLKIILISKLSGVVELEAGELDSFVDKLTNMPCELNIINDNVEHQAGSDEQE
EDGLGFDALGIFSQRGNRSKEQRKNEKLLADIVFKSNGALCNIDSAELLLVHFERKVTRS
MPWNCMLTIGSKLQISTSTYVLISEEKGLSSFKTECVDPNAVVKLKTDHFKNDKLYEPDF
EDLIKGYMYGSTVVPYDSQMDFDYKSGEQCLSCLGFTAAGNILEEYLCGTGTHVVVAKKD
CAASEAKLTALIKAMLELDVVMIATKVYRRDTKPKIQALFPTFRRRFPCLTMLELVFQEE
VALLKFPPLLSNRHKPTDAQYEAVDKLIDAMDLMDGLDDETGSKEAFALHKTLNPIHQHM
YRTVAHRAIHPKAPLPAMDEELRQLVDVPSKIRERSKEALEDIKNLFPLKELKVNAQLKW
LQKTAKINVQPDGDAAGSSSQPNDGSADEELDDHRTVVEVGTVTPAEDFALLLKRGEKFA
TVCTQIQNVISGLVFKSMTTQYEKVAMAIMIFREEAKLLGPYRFNEWIGEFKKSLLSRNK
QEFWQRVVVQERFGLIGAAESEMSTITANEVEEFYDVGVTSKVGSAEDNADYVDADDLFA
NM
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggcgcgtacaaaggaagcctgtatactgattttggacgttggaaaggacaccttggtc
aaaagtggcaagaatgatctgacgttcttcgaaagggccaaaggatgtgttacaaaaatc
gtccaacggaagattttcagcaagccacacgacgaagtagggttggtgctgatgggtaca
gatgatacgagcaaccaactgaatgtcgaatgcggcgggtatgagcacattgccgaggcg
ttcgagctgggaccctcaaactggaagatgctacggattttggagagccgcatccaaccg
tcaaaagtgaacgccaactggttcgacgccctgctggtggcgacaaactttttgaaggtt
ggcgctcaggccaagaaattcgccaccctcaagatcattctgatatcgaaactttccggc
gtggttgaactggaagccggtgagcttgattcgtttgttgataaacttaccaacatgccc
tgcgagctgaacataatcaacgacaatgtcgaacaccaggcagggtcggacgagcaagag
gaggatggtttagggttcgacgcgcttggaatatttagccagcgcggaaatagaagtaag
gaacaacgtaaaaatgagaaattactggcggatatcgtgttcaagtcgaacggcgctctc
tgcaacattgactcggcggaactgctgctggtccacttcgagcgaaaggtaactcgatca
atgccgtggaactgtatgctgactatcgggtcaaagctgcaaatcagcacttcaacgtat
gtactgatatctgaagagaaagggctgagctcgttcaagactgaatgtgtcgatccgaac
gcggtcgtcaagttgaaaacggaccacttcaaaaacgacaagctgtacgagcccgacttc
gaagacctcatcaagggctacatgtacggtagtaccgtagttccgtacgacagccagatg
gactttgattacaaatccggcgagcagtgtctttcctgtttgggattcacggcggctggt
aacatactcgaggaatatctgtgcggcaccggcacgcacgtggtcgtggccaagaaggat
tgtgctgcgtccgaagcgaagctaactgcgttgatcaaggccatgctcgagctggatgtg
gtgatgatcgctaccaaagtataccgacgggataccaagccaaagattcaagcacttttt
cccacattccgcagacggtttccctgcctgacgatgttggagctggttttccaagaggaa
gtggcactgctaaagttcccacctttgttgtccaacagacacaagccaaccgacgcgcag
tacgaagccgttgataagttgatcgatgccatggacctgatggacggtctggacgacgaa
acgggttcgaaggaggcgttcgccctccacaaaaccctcaatccaatccatcagcacatg
taccgtacggtggcccaccgtgcaatccacccgaaagcaccacttccggcgatggacgaa
gagctgcgacagctggttgacgtcccatccaagatacgagagcgatccaaggaagcccta
gaggacatcaagaacttgttcccgctaaaggaattgaaggtaaacgctcagctcaagtgg
cttcaaaaaacggccaagatcaacgtccaaccggatggcgatgcggcgggcagtagctca
caaccgaacgatggctccgccgacgaagagctggacgatcacaggaccgtggttgaggtg
ggcaccgttacccccgcggaagactttgccctactgctgaagcgcggtgaaaagttcgcc
accgtctgcacccaaatacagaacgtcatctcgggcttggtgttcaaatccatgaccacg
cagtacgaaaaagtcgccatggccatcatgatattccgcgaggaagcgaagctgctcggt
ccgtaccggttcaacgagtggatcggcgagttcaagaagagcctactgtcgcgcaacaag
caggagttttggcagcgagttgtcgtgcaggaacggttcggcctcatcggtgcggcggaa
agcgaaatgagcacgataacggcgaacgaggtggaggagttttacgacgttggcgtcacg
agtaaggtcgggtctgcggaagataacgccgattacgtggatgcggacgacctgtttgcc
aacatgtaa

DBGET integrated database retrieval system