KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011611Help
Entry
CpipJ_CPIJ011611  CDS       T01079                                 

Definition
(RefSeq) 15E1.2 protein
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00970  Aminoacyl-tRNA biosynthesis
cqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CpipJ_CPIJ011611
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cqu03029]
    CpipJ_CPIJ011611
Enzymes [BR:cqu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CpipJ_CPIJ011611
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CpipJ_CPIJ011611
Mitochondrial biogenesis [BR:cqu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CpipJ_CPIJ011611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln Jag_N
Motif
Other DBs
NCBI-GeneID: 6044282
NCBI-ProteinID: XP_001861813
VectorBase: CPIJ011611
UniProt: B0WWP1
AA seq 156 aa AA seqDB search
MIRIPFHLRQPPGRTLHSLEKSTRQKINFHELKHPSKVPQRPHKSTIDGQSTPTRIPVDA
QTVQLLERLSLVDLDSAKAHRTLEDAIEFASQILSVDTDGVEPLYTVLERERLTLREDRV
SDGNIQQDVLRNARVTEEENFVAPPENIPLEQEPRK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgattagaattccgttccatctacgacaacccccgggacgcaccctccactcgctggaa
aagagcacccgtcaaaagatcaatttccacgagcttaaacatccgagcaaggttccccag
cgtccacacaaatctacgattgacggccagtcgacaccaacccgcatcccggtggacgcc
caaacggtgcagttgctggagcggttaagcctggtggatctggacagcgccaaggcccac
cggacgctcgaggacgcgatcgagtttgcgtcgcagattctgtccgtggacaccgacggc
gtagaaccgctgtacacggtgctggagcgggagcggttgacgctgcgcgaggaccgcgtg
tccgacgggaacatccagcaggatgtgctgaggaatgcacgtgttaccgaggaggagaac
tttgtggcgccaccggaaaatattccactcgagcaggaaccgaggaagtga

DBGET integrated database retrieval system