KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012071
Entry
CpipJ_CPIJ012071  CDS       T01079                                 
Name
(GenBank) myokinin receptor
  KO
K14071  leucokinin receptor
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cqu04030]
    CpipJ_CPIJ012071
G protein-coupled receptors [BR:cqu04030]
 Rhodopsin family
  Peptide
   Tachykinin
    CpipJ_CPIJ012071
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-ProteinID: EDS37055
VectorBase: CPIJ012071
UniProt: B0WYH8
AA seq 569 aa
MVHRAGCRTAGVKPHPELGIGIREDKEHDSVVKWYCVRTERINPEITENVLYDVPVGLVV
LLSVFYGTISVLAVIGNSLVIWIVLTTKQMQTITNMFIANLALADVIIAMFAIPFQFQAA
VLQRWNLPDFMCPFCPFVQLLSVNVSVFTLTAIAVDRHRAIINPLRARTSKNISKFVISA
IWTLSFSLAAPMLVALRVEPVSNLVLGENNDTYVNVTKPFCQVVNFEQSEMLFYRYILTL
VQYFVPLCVISFVYIQMAFRLWGSKTPGNAQDSRDITMLKNKKKVIKMLIIVVALFGICW
FPLQLYNILHVTWPEVNQYRYINIIWFICDWLAMSNSCYNPFIYGIYNEKFKREFHKRFP
FRGRGQGGYHQDQSIDKTLSIFTRVSSVRSSYATSSIRNKHATGRPAAAIGGFGTGTNFY
HQQALQYKTTNLNNQDRSPNGRLNNGPAPWDSKACSCRKSTNSNGSNSASVQLLGTGTDS
SFPRNEPDCARYQAGSTPPSERKLINGTADKIDFIDIVSLNHPHPDSADDGEVDDENGLN
DLNRRQKSAASGDRFHLYCNNLQTFKLYD
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggttcaccgggccggatgtcgtacggccggggtgaaaccacacccagaactgggcatc
ggcatacgagaggataaagagcacgattcggtagtaaaatggtactgtgtgcggacggag
aggataaatcccgaaattaccgagaacgtcctgtacgacgttcctgtggggctggtcgtg
ctgctgtcggtgttctacggcaccatcagcgtcctggctgtgataggcaactcgctggtg
atatggatcgtcctgacgacgaagcagatgcaaactattacaaacatgtttatagcgaac
ctggccctggccgacgtcatcatcgcgatgttcgcgattccgttccagttccaggccgcc
gtcctgcagcggtggaacctgccggactttatgtgcccgttttgtccctttgtgcagctg
ctcagcgtcaacgtgtccgtgttcacgctgaccgcgatcgccgtcgaccggcaccgggcc
atcatcaacccgttgagggcccgcacctccaaaaacatctccaagttcgtgatcagcgcc
atctggacgttgtcgttttcgctggccgccccgatgctggtcgccctgcgggtcgaaccg
gtgtccaacctcgtcctgggggaaaacaacgacacgtatgtcaacgtgacgaaacccttc
tgccaagtggtcaactttgagcagtccgagatgctgttctatcggtacattctgacgctg
gtgcagtactttgtcccgctgtgcgtcatcagcttcgtgtacatccagatggcgttccgg
ttgtggggctcgaaaacgcctggaaatgcgcaagattcgcgcgacatcaccatgctgaag
aacaagaagaaggttatcaaaatgttgatcattgtggtggccctcttcggcatctgctgg
tttccgctgcaactgtacaacattctacacgtaacgtggccagaggttaatcagtaccgg
tacatcaacatcatctggttcatatgcgactggttggccatgagcaacagctgttataat
ccgttcatttatggcatttacaatgaaaagttcaaacgagagttccacaagcggtttccg
ttccggggccgaggccagggcggctaccaccaggaccagtcgattgataaaaccctgtcg
atattcacccgcgtcagctcggtccggtccagctacgcgacgtcctcgatccggaacaag
cacgccaccggacggccggcggctgccatcggtggctttggaaccggcacaaacttttat
catcagcaggcactgcagtacaaaacgacgaatctcaacaaccaggaccgcagtccaaac
ggccgactcaacaacggcccggcaccatgggattccaaggcttgttcctgccgcaagtca
accaacagcaacggttcaaactccgccagcgtgcagctgctcggcaccggaaccgactcc
tcgtttccccgcaacgaaccggattgtgcgcgataccaggccggatcgacgccaccgagc
gagcggaagcttatcaacggaactgcggacaagatcgattttatcgacattgtctcgttg
aatcatccccacccggacagcgccgacgacggcgaggtggacgacgagaatggtttgaac
gatctgaaccggaggcaaaagtcggcggcttccggcgatcggtttcacttgtactgtaac
aatttgcagacctttaagctgtatgactag

DBGET integrated database retrieval system