KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013094Help
Entry
CpipJ_CPIJ013094  CDS       T01079                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00010  Glycolysis / Gluconeogenesis
cqu00260  Glycine, serine and threonine metabolism
cqu01100  Metabolic pathways
cqu01200  Carbon metabolism
cqu01230  Biosynthesis of amino acids
Module
cqu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cqu_M00002  Glycolysis, core module involving three-carbon compounds
cqu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpipJ_CPIJ013094
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpipJ_CPIJ013094
Enzymes [BR:cqu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CpipJ_CPIJ013094
Membrane trafficking [BR:cqu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CpipJ_CPIJ013094
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CpipJ_CPIJ013094
  Exosomal proteins of melanoma cells
   CpipJ_CPIJ013094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 6046157
NCBI-ProteinID: XP_001863396
VectorBase: CPIJ013094
UniProt: B0X174
AA seq 252 aa AA seqDB search
MAKYSVVFVRHGESEWNKMNLFCGWHDVGLSEEGEWDALEISAASLKRENITFDVAFTSC
LRRANQTLDVIRRELNLGHIPVHQLWRLNERHYGALTGFNKRQMADIYGEPQVQVWRRSF
NVPPPAIEPNNPYYGAIRNNPKFRHIAEKDFPLTETLETTMQRVVPEWTDTIIPEVRAGK
KVLVVAHGTSLRGLVKHIQDISDADIMKFNLPNSIPFIFDFDENMKMVGGIRFLANEDTV
IKAMEKVASIGK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggccaagtacagtgtggtgtttgtgcgccacggcgaaagtgaatggaacaagatgaat
ctcttctgcggctggcatgacgttgggctgagcgaggaaggtgaatgggacgcgctggag
atatcggccgcctcgctgaagcgcgaaaacatcaccttcgatgtggccttcacgtcgtgc
ctccggcgggccaaccaaacgctggacgtgatccggcgcgagctgaatctcggccacatc
ccggtgcaccagctgtggcggctgaacgagcgccactacggcgccctgaccgggttcaac
aagcgccagatggcggacatttacggtgaaccgcaggtgcaggtgtggcgccgcagcttc
aacgtcccgccaccggcgatcgagccgaacaacccgtactacggtgccatccggaacaac
cccaagtttcgacacattgccgagaaggacttcccgctcacggaaacgctcgagactacg
atgcagcgggtcgtgcccgagtggaccgatacgatcattccggaggtgcgcgccggcaag
aaggtgctggtggtggcccatggaacgagccttcggggactggtcaagcatattcaagat
atttcagatgccgacattatgaagttcaatctgcccaacagtattccgttcatcttcgac
tttgacgagaacatgaagatggtcggtggcatccggtttctcgcgaacgaggacaccgtc
atcaaggcgatggagaaggtcgcctcgattggcaagtag

DBGET integrated database retrieval system