KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013476Help
Entry
CpipJ_CPIJ013476  CDS       T01079                                 

Definition
(RefSeq) chitooligosaccharidolytic beta-N-acetylglucosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00511  Other glycan degradation
cqu00520  Amino sugar and nucleotide sugar metabolism
cqu00531  Glycosaminoglycan degradation
cqu00603  Glycosphingolipid biosynthesis - globo and isoglobo series
cqu00604  Glycosphingolipid biosynthesis - ganglio series
cqu01100  Metabolic pathways
cqu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CpipJ_CPIJ013476
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CpipJ_CPIJ013476
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    CpipJ_CPIJ013476
   00604 Glycosphingolipid biosynthesis - ganglio series
    CpipJ_CPIJ013476
   00511 Other glycan degradation
    CpipJ_CPIJ013476
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CpipJ_CPIJ013476
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CpipJ_CPIJ013476
Chaperones and folding catalysts [BR:cqu03110]
 Intramolecular chaperones
  Others
   CpipJ_CPIJ013476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 6047330
NCBI-ProteinID: XP_001864406
VectorBase: CPIJ013476
UniProt: B0X434
AA seq 589 aa AA seqDB search
MLNSFRAPAWGYRCTNSRCEKVPIGDDPAAREKAVSLSVCRLYCGDGGVIGTVWPRPTGN
YQLGNDLVHVDPYKVEFQWGKVLGALGKYWDAAIERFRGQLKVRSDGEELRGGGKRMVVK
VNVEDDSLVLNHGTDEGYKLTVGRIGGGDVMVTIDAANYFGARHGLETLAQLVVFDDIRM
ELQIVGAVEIQDAPVYTHRGLSLDTSRNYVDVASIKRTIDALAMVKMNVFHWHITDSQSW
PLVIRSQPTLHTYGAYSRKEVYTAKDVQDIVEYALARGVRVVPELDAPAHVGEGWEKTNL
TSCFNYQPWTKYCVEPPCGQLDPSKDKVYDVLEDIYREMNAMFTHSDVFHMGGDEVSVSC
WNTSTEIQQWMKAQGWGLEEADFLKLWNHFQTNALKRLDKSLKDNRPIVMWTSRLTEEPY
VDQYLDKDRYIVQIWTTGDDPKIAKLLQKGYRLIISNYDALYLDCGFAGWVQGGNNWCSP
YIGWQKVYNNDLKTVAPSPQHSSQILGAEATLWTEQADTLSLDARFWPRVSALAERLWTD
PSEGWQAADSRMLVHRERLVENGIAAESLQPKWCLQNEGHCPIEQGGRV
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacagcttccgcgctccagcctggggctaccgctgcaccaacagccgttgcgag
aaggtcccgatcggggacgatcccgccgcacgggagaaggccgtaagcctgtcggtgtgt
cggctgtactgcggcgatggtggcgtcatcggcacggtctggccccgcccaaccgggaac
taccagctggggaacgacctggtgcacgtggacccgtacaaggtggagttccagtggggc
aaggtgctgggggcgctcggcaagtattgggacgcggcgattgagcggttccgggggcaa
ttgaaggtgcggtcggatggtgaggagttgaggggtggtgggaagaggatggtggttaag
gtgaatgttgaggatgattcgctggtgttgaatcacgggacggacgagggatataagttg
acggtggggaggattgggggtggggatgttatggtgacgattgatgcggcgaattatttt
ggggcgcggcacgggttggagacgttggcgcagttggtggtgtttgacgacattcggatg
gagttgcagattgtgggggcggttgagattcaggatgctccggtgtatacgcatcgtggg
ttgtcgttggacacttcgagaaactacgttgacgtggcttcgattaagagaactattgat
gcgttggccatggtcaagatgaacgtgttccattggcacattaccgattcgcagagttgg
ccgttggttattaggtcgcagccgacgctgcacacttacggagcgtactcgcgcaaggag
gtctacacggcaaaggacgttcaggatattgtggagtacgcgttggctcgcggagttcgt
gtcgttccggaactggacgcgccggctcacgttggtgagggttgggaaaagactaacctg
acaagttgcttcaactatcaaccatggaccaagtactgcgttgagccaccctgcggtcag
ctggatccgtccaaggacaaggtgtatgatgtgcttgaggatatctaccgtgaaatgaac
gccatgtttacgcactcggacgtgttccacatgggtggggacgaagtttcggtcagttgc
tggaacaccagcaccgaaatccaacagtggatgaaggcccaaggttggggcctcgaagaa
gccgacttcctcaagctgtggaaccatttccaaaccaacgccctcaagcggctcgacaaa
tccctcaaagataaccgtcccatcgtcatgtggactagcaggctaaccgaggaaccctac
gtcgaccagtacctcgacaaagaccggtacatcgtccaaatctggaccaccggcgacgat
cccaaaatcgccaaactcctccagaaaggctaccgtctcattatttccaactacgacgcg
ctctatctggactgcggcttcgctggttgggtccagggcggcaataactggtgctccccc
tacatcggctggcaaaaggtctacaacaacgacttgaaaacggtcgccccctccccccaa
cactcgtcgcagatcctgggcgctgaagcaaccctgtggaccgaacaagcggacaccctt
tcgctggatgcgcgcttttggcctcgagtgagtgccctggcggaacgcctctggacggac
cccagtgagggctggcaggcggccgattcgcgcatgttggtgcaccgcgagcggctcgtg
gagaacggcatcgcggcggagagtttgcagcccaagtggtgcctccagaacgaggggcac
tgcccaattgagcagggtggcagggtgtga

DBGET integrated database retrieval system