KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013834
Entry
CpipJ_CPIJ013834  CDS       T01079                                 
Name
(GenBank) ARP2/3 complex 21 kDa subunit
  KO
K05756  actin related protein 2/3 complex, subunit 3
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CpipJ_CPIJ013834
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cqu04131]
    CpipJ_CPIJ013834
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cqu04812]
    CpipJ_CPIJ013834
Membrane trafficking [BR:cqu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    CpipJ_CPIJ013834
Cytoskeleton proteins [BR:cqu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     CpipJ_CPIJ013834
SSDB
Motif
Pfam: P21-Arc dNK
Other DBs
NCBI-ProteinID: EDS39496
VectorBase: CPIJ013834
UniProt: B0X2Z4
AA seq 178 aa
MPAYHSQIKDYSQSVGNMAILPLRTQARGPAPTNASIEQDIIDESLYYFKANVFFRTYEI
KSEVDRVLIYITLYITECLKRLQRCSNKNQGLQEMYTLAISKFDIPGEAGFPLNAVYAKP
AGPSEADLMKQYLQQLRQEIGIRVCERVFSGEDGKPSKWWLCFAKKKFMDKSLSGPGQ
NT seq 537 nt   +upstreamnt  +downstreamnt
atgccggcttatcattcccaaatcaaggattactcccaatccgtgggcaatatggcgatt
ctgccgctgcgaacgcaggcccgcggtccggccccgaccaacgccagcatcgagcaggac
attatcgacgagtcgctgtactacttcaaggcgaacgtgttcttccgcacgtacgagatc
aagtccgaggtggaccgggtgttgatctacattacgctgtacatcaccgagtgcttgaag
cggctgcagcgctgctcgaacaagaaccagggcctgcaggagatgtacacgctggccatc
tccaagtttgacatcccgggcgaggcgggcttcccgctgaatgcggtgtacgcgaagccg
gccggcccgtccgaggcggacctgatgaagcagtacctgcagcagctgcgccaggagatt
ggcatccgggtgtgcgagcgggtcttctccggcgaggacggcaaaccgagcaagtggtgg
ctgtgcttcgccaagaagaagttcatggacaagtcgctgtccggaccgggccagtaa

DBGET integrated database retrieval system