KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014089Help
Entry
CpipJ_CPIJ014089  CDS       T01079                                 

Definition
(RefSeq) cyclophilin
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CpipJ_CPIJ014089
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cqu03041]
    CpipJ_CPIJ014089
   03110 Chaperones and folding catalysts [BR:cqu03110]
    CpipJ_CPIJ014089
Enzymes [BR:cqu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CpipJ_CPIJ014089
Spliceosome [BR:cqu03041]
 Complex B
  Other components
   Prp19-related factors
    CpipJ_CPIJ014089
 Complex C
    CpipJ_CPIJ014089
Chaperones and folding catalysts [BR:cqu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    CpipJ_CPIJ014089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 6046953
NCBI-ProteinID: XP_001864072
VectorBase: CPIJ014089
UniProt: B0X350
AA seq 176 aa AA seqDB search
MLALQPGTTTTGIPDKLWQPHFVTFETSMGEISIELYWKHAPNTCRNFAELTRRGYYNGT
IFHRIIRDFMIQGGDPTGTGRGGSSIYGATFADELNGDLKHTGAGILSMANSGPDTNGSQ
FFITLAPTQWLDGKHTIFGRIHTGMQVVKRIGLAETDKNDRPVEQVKILKGKVEKY
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccttcagccaggaacgaccaccaccggcattccggacaagctgtggcagccg
cactttgtcacgtttgaaacgagcatgggcgaaatctcgatcgagctgtactggaagcac
gcccccaacacgtgtcgcaactttgccgagctgacgcgccgtggctactacaacggcacg
atcttccaccgcattatccgcgactttatgatccagggcggcgatccgacggggacgggc
cgcggcggaagctcgatctacggggccacctttgcggacgagctgaacggggacctgaag
cacaccggggcggggattttgtcgatggccaattccggaccggataccaacgggtcgcag
ttctttatcacgttggcgccgacgcagtggctggatgggaagcatacgattttcggacgg
attcacacggggatgcaggtcgtgaagcggataggactggccgagacggacaagaatgat
cgcccggtggagcaggtcaagattttgaagggtaaggtggagaagtattga

DBGET integrated database retrieval system