KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014114Help
Entry
CpipJ_CPIJ014114  CDS       T01079                                 

Definition
(RefSeq) N6-adenosine-methyltransferase IME4
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cqu03019]
    CpipJ_CPIJ014114
Enzymes [BR:cqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     CpipJ_CPIJ014114
Messenger RNA biogenesis [BR:cqu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     CpipJ_CPIJ014114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 6046849
NCBI-ProteinID: XP_001863984
VectorBase: CPIJ014114
UniProt: B0X2W2
AA seq 601 aa AA seqDB search
MSLEEIQAVKVKRNSLRERLEKRKKERQDLLGGGGSSPGPSVLIKTEAGAGGAGGDDKSK
ILLTAIKLEQDIDAEVEKALVQVLADRTAILPTNSSQIAQRVEKLIQKPTPHETVRYYLQ
KLSGQHLVSVKEVSIGGSVGYEVISAEHGALQTLHDEVLMNHGEDRESAKRKAIKEEKDL
DSKVARLTSSGGGGDSAGSSSLANTSDDIMSLLSMPSTREKQSKQVGEEILELLTKPTAK
ERSLAEKFKSQGGAQVMEFCPHGTRIECLRSLEAANDAHLHKDDDDDDVIISGDDNGVFE
IVEIKKDPDAEKIKFQCNKLHFKKIIQSHTDESLGDCSFLNTCFHMDSCKYVHYEVDTYG
LNTSSSKFDPETSLLGAKRVTNDPCATLYPPQWIQCDLRYLDMTVLGKFAVVMADPPWDI
HMELPYGTMSDDEMRQLGVPALQTDGLIFLWVTGRAMELGRECLKLWGYERVDELIWVKT
NQLQRIIRTGRTGHWLNHGKEHCLVGMKGNPPNLNRGLDCDVIVAEVRATSHKPDEIYGI
IERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIRLVDPELISSFQKRYPDGNCMTPGKN
P
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggaggagatccaagccgtcaaggtgaagcgaaattcgctgcgggagcggctg
gagaagcgcaaaaaggagcgccaggatttgctcggcggcggtggcagcagcccggggcca
agtgtcctcattaagacggaagctggggctggtggtgccggcggggatgacaagagcaag
attctgctgacggcgatcaagttggaacaagatattgacgcggaggttgagaaagcgctt
gtccaggtgttggccgatcggaccgctattttgccgaccaactcgtcccagattgcgcaa
cgggtggagaagttgatccagaagccgacgccacacgaaacggtgcggtattatttgcag
aagctgtccgggcagcacctggtcagcgtgaaggaggtcagcattgggggaagcgtcggg
tacgaggtcatttcagcggaacacggagcgctacagacgctgcacgatgaagtgctgatg
aatcatggtgaggaccgggagtcggctaaaaggaaggcgatcaaagaggagaaggatttg
gactcgaaggtggcccggttgacgtcttcggggggaggtggggactcggccggttcgtca
tcgttggccaacacgtcggacgacataatgtcgctgctgtcgatgccatcgacgcgggag
aagcagagcaaacaggttggggaggagattttggaactgttgacgaagccaacggccaag
gagcgatcgctggcggagaagtttaagtcgcaaggcggtgcgcaggtcatggagttttgt
ccgcacggaactaggatcgagtgtttgaggtcgctggaggcggccaacgatgcgcatctt
cacaaggacgacgacgatgatgatgttatcattagcggggacgacaacggagtgtttgag
atcgtagaaatcaagaaagatccggacgccgaaaagatcaagttccagtgcaacaagctg
cacttcaagaagatcattcaatcccacacggacgaatcgcttggggattgcagcttcctg
aacacttgctttcacatggacagctgcaagtacgtacactacgaagtggacacttacggc
ctcaacacgagcagttccaagttcgatccggaaacttcactgcttggagccaagcgagtc
accaacgacccgtgcgccaccctctacccacctcagtggatccagtgtgacctgcgctat
ctggacatgaccgtcctgggcaagttcgccgtcgtaatggcagacccgccctgggacatt
cacatggaactgccgtacggaaccatgtccgacgatgagatgagacagctgggcgtgccc
gccctccaaacggacggtctcatctttctgtgggtcaccggccgtgctatggaactcggt
cgcgagtgcctcaaactgtggggctacgaacgcgtcgacgaactgatctgggtcaagacg
aaccagctgcagcggataatccgcaccggtcggaccggccactggctgaaccacggcaaa
gagcactgcctggtgggcatgaagggcaacccgccgaacctgaaccgcggcctggactgc
gacgtcatcgtggcggaagtgcgcgcaacctcgcacaaaccagacgaaatctacggcatc
atcgagcggctcagcccgggcacgcggaagatcgagctgtttggaaggccgcacaacgtg
cagccgaattggattacgctcggcaatcagctggacggcatccggttggtggatccggag
ttgattagttcgtttcagaagcgttacccggacgggaactgcatgacgcccggaaagaat
ccgtaa

DBGET integrated database retrieval system