KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014719
Entry
CpipJ_CPIJ014719  CDS       T01079                                 

Name
(GenBank) alaserpin
  KO
K13963  serpin B
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ014719
Peptidases and inhibitors [BR:cqu01002]
 Peptidase inhibitors
  Family I4: serpin family
   CpipJ_CPIJ014719
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-ProteinID: EDS41130
VectorBase: CPIJ014719
UniProt: B0X5Z9
AA seq 377 aa
MATEIDAQFASKTNDFALELYKQIASSDKKNVIISPLSISTCLSLAACGAAGETAEEMFS
VLKYDGAAQKQSVAQQYGRVLAGLNANPTLSIANKVYVMDKYTVKAGFSEVAQKSFYSEA
ETVNFGENDAAAKKINGWVEQKTNDKIKDLISSDCLGQDTRMVLVNAIHFKGTWKHQFDK
QQTIPMPFWISATESIEVPTMNIKKHFNYGVFEELNASALELTYSDGDLSMLILLPNERD
GLPKLEEKLQSINIADLTSKMYSQEVEVALPKFKIEFDVDLKETLEKLGMGTMFTDKADF
SELLEQPDPLYVSKVVHKAFIEVNEEGTEAAAATGMIMMARCMIFPARFAVEHPFYFALL
DRKLDLVAFNGRVRDPK
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggccaccgaaattgacgcccagtttgccagcaaaaccaacgattttgcattggagttg
tacaagcaaattgcttcaagcgataagaagaatgttatcatttcaccgctctctatcagc
acctgcctatcgttggcggcgtgcggcgcggctggtgaaaccgccgaagaaatgttctcg
gtgctaaagtatgacggcgccgcccagaagcaatccgtggcgcaacagtacggccgagtg
ttggccgggctgaacgccaacccgacgctgagcatcgccaacaaggtgtacgtgatggac
aagtacacggtcaaggccggtttcagcgaggtcgcccagaagagcttctactccgaggcc
gagacggtcaactttggtgagaacgatgccgcggccaagaagatcaacggttgggtcgaa
cagaagaccaacgacaagatcaaggatctgatttcgtcggattgcctcggtcaggatacc
cgaatggtactggtcaacgcgatccacttcaagggaacctggaagcaccagtttgacaag
cagcagaccatcccgatgcccttctggattagcgccacagaatcgatcgaggtcccgacg
atgaacatcaagaagcacttcaactacggcgtctttgaagagctcaacgcgtcggcactc
gagctcacctacagtgacggagacctgagcatgctgattctgctgcccaacgaacgcgac
gggctgccaaagttggaggagaaactacaaagtattaacattgcggaccttacgtccaaa
atgtacagccaggaggtggaggttgcgctacccaagttcaaaatcgaattcgatgtggat
ctgaaggagacgctcgaaaagctcggaatgggaacgatgttcacggacaaggccgacttc
agcgaactgttggagcaacccgacccgctgtacgtctcgaaggtcgttcacaaggccttc
atcgaagttaatgaggagggaacggaagcggctgccgcaactggtatgataatgatggcc
cgctgcatgatcttcccggcccggttcgccgtcgagcatccgttctactttgccctgctt
gaccggaagctggacctggtggcgttcaacggacgtgtgcgggatccgaagtag

DBGET integrated database retrieval system