KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014768
Entry
CpipJ_CPIJ014768  CDS       T01079                                 
Name
(GenBank) histone 1
  KO
K11254  histone H4
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ014768
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    CpipJ_CPIJ014768
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP
Other DBs
NCBI-ProteinID: EDS41246
VectorBase: CPIJ014768
UniProt: B0X696
AA seq 117 aa
MYHLNFKTSRSSTKMTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKR
ISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 354 nt   +upstreamnt  +downstreamnt
atgtatcacttgaactttaaaacatcaaggagctcaactaagatgactggacgcggcaag
ggaggcaaaggactcggaaaaggaggcgccaagcggcatcgcaaggttcttcgtgataac
atccagggcatcaccaagccggccattcgtcgtctggcccgtcgtggcggtgtgaagcgc
atctccggtctgatctacgaggaaactcgcggtgtgctgaaggtgtttctggaaaacgtg
atccgtgatgcggtcacctacaccgagcacgccaagcggaagaccgtcacggccatggac
gtcgtgtacgccctgaagcgccagggacgcacgctgtacggtttcggaggataa

DBGET integrated database retrieval system