KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014934
Entry
CpipJ_CPIJ014934  CDS       T01079                                 
Name
(GenBank) malonyl CoA-acyl carrier protein transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00061  Fatty acid biosynthesis
cqu01100  Metabolic pathways
cqu01212  Fatty acid metabolism
Module
cqu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CpipJ_CPIJ014934
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CpipJ_CPIJ014934
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cqu01004]
    CpipJ_CPIJ014934
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     CpipJ_CPIJ014934
Lipid biosynthesis proteins [BR:cqu01004]
 Fatty acid synthase
  Component type
   CpipJ_CPIJ014934
SSDB
Motif
Pfam: Acyl_transf_1
Other DBs
NCBI-ProteinID: EDS41079
VectorBase: CPIJ014934
UniProt: B0X5U7
AA seq 389 aa
MWRNSGQALSSKPPDKSTAALGEEKVRDLLDNAATFEDAKPRSEQDTWATLPYVDGTFMG
RDQSLKSSRPRIDPRETSIILFPGQGAQYVGMAKRLLKYPGARDIFQLANEVLGYDLLKL
CLDGPREKLDQTRHCQPAVMVSSLAALEQLKEERPNAIENCFATAGFSLGEISALVFAGA
LPFDKALRLVQIRAEAMQLASEQHTSGMATVLYGADARIGEACKGALDWCIQRGVESPEC
RIANYLYPSCKVIAGSEDALKFLEANGKKYGIKRIKRLPVSGAFHTELMASAVEPFAKAL
KKITIEDPIIGVYSNVDGKRYRNAGHILGQLPKQITRPVKWEQTLHNLYERKAGENFPRT
FECGPGQGLKTILKQVNGKAWDSAFSIEA
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtggcgaaacagcggacaggccctgtcgtcgaaacctccagataaatcaaccgccgcc
cttggcgaggaaaaggttcgcgatctgctggacaatgccgccacgtttgaggacgcgaaa
ccacgctccgagcaggacacctgggccacactgccctacgtggacggcacgttcatgggc
cgggaccagtcactgaaatcgtcgcgaccccggatcgatccccgtgaaacttccatcatt
ctgttcccgggccagggtgcgcagtacgtcggaatggcaaagcggttgctgaagtacccg
ggtgcgcgggacatcttccagctggccaacgaggtgctcgggtacgatctgttgaaactt
tgtctggacgggccccgggagaagctggaccaaacgaggcactgccagccggcggtcatg
gtttcgtcgttggccgcgctggaacagctcaaagaggagcggccgaacgcaattgagaac
tgcttcgccacggccggattcagtttgggcgagatttccgcgctggtttttgccggagca
cttccgttcgataaagcgctcagattggtgcagattcgagccgaggcgatgcaactggcc
agcgagcagcacacaagcggaatggccacggttctgtacggagcggacgcccgcatcggg
gaggcctgcaagggtgccctggattggtgcattcagcggggcgtagaaagtcccgagtgc
cggatagcgaactatctctacccaagctgcaaggtcattgccggcagcgaagacgcgctc
aagttcctcgaagcgaacgggaaaaagtacggcatcaaacggatcaagcgacttccggtc
agcggggccttccacaccgaactgatggcgtcggccgtggaaccgtttgcgaaggcactc
aaaaagatcaccatcgaagatccgatcatcggcgtttactcgaacgtggacggcaagcgg
taccgaaatgcgggccacattctgggccagctgccgaagcagattacgcgacccgtcaag
tgggagcaaacgttgcacaatctgtacgagcggaaggcgggggagaacttcccgcggacg
ttcgagtgcggtcctgggcaaggcttgaagacgattctgaagcaggtcaacgggaaggcg
tgggactcggcgttcagcatagaggcgtga

DBGET integrated database retrieval system