KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015233Help
Entry
CpipJ_CPIJ015233  CDS       T01079                                 

Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00480  Glutathione metabolism
cqu00980  Metabolism of xenobiotics by cytochrome P450
cqu00982  Drug metabolism - cytochrome P450
cqu00983  Drug metabolism - other enzymes
cqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CpipJ_CPIJ015233
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CpipJ_CPIJ015233
   00982 Drug metabolism - cytochrome P450
    CpipJ_CPIJ015233
   00983 Drug metabolism - other enzymes
    CpipJ_CPIJ015233
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cqu02000]
    CpipJ_CPIJ015233
Enzymes [BR:cqu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CpipJ_CPIJ015233
Transporters [BR:cqu02000]
 Other transporters
  Pores ion channels [TC:1]
   CpipJ_CPIJ015233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 6048852
NCBI-ProteinID: XP_001865699
VectorBase: CPIJ015233
UniProt: B0X7S7
AA seq 148 aa AA seqDB search
MTTLFDAIDPRAFRSYVFWSAVLVFKMLMMSYLTGRKRFGRKVFANPEDAAMTGAREVRT
DPEVERVRRAHQNDVENIPLFVAIGFLYLLTGPDVTLAVTLFRLVGIARIVHTLVYAVVV
VRQPARMVAWFLAYIPTIYMTLATVVKG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccttttcgacgccatcgacccgcgcgccttccgctcgtacgtgttctggtcc
gcggttctcgtgttcaagatgctcatgatgtcctacctgaccgggcgcaagcgcttcggc
cggaaggtgttcgccaacccggaggacgccgccatgaccggcgccagggaggtgcgcacg
gatccggaggtggagcgggtacgccgcgcccatcagaacgacgtcgagaacatcccgctg
tttgtggcgatcggattcctgtacctgctgaccgggcccgacgtaacgctggccgtgact
ctgttccggctcgtcggaatcgcccggattgttcacaccttggtgtacgccgtggtggtg
gtgcgccaaccggcgcggatggtcgcctggttcctggcgtacatcccgacaatctacatg
accctggctaccgtggttaaaggttaa

DBGET integrated database retrieval system