KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015273
Entry
CpipJ_CPIJ015273  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CpipJ_CPIJ015273
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cqu01007]
    CpipJ_CPIJ015273
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cqu03016]
    CpipJ_CPIJ015273
Enzymes [BR:cqu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     CpipJ_CPIJ015273
Amino acid related enzymes [BR:cqu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   CpipJ_CPIJ015273
Transfer RNA biogenesis [BR:cqu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CpipJ_CPIJ015273
 Prokaryotic type
    CpipJ_CPIJ015273
SSDB
Motif
Pfam: tRNA-synt_1b DUF6002
Other DBs
NCBI-ProteinID: EDS41889
VectorBase: CPIJ015273
UniProt: B0X7D9
AA seq 372 aa
MFKSLSCLRLVRPTVRYASTEAMAPSWPRKIFSGVQPTGALHIGNYLGAIKRWVDLQNSG
EDVTYCIVDLHSITLPQDPDLLRHNSLQMAATLLACGIDPAKSTLFLQSGVPQHAELSWI
LGCMTTMARLTHLPQYKEKSAKLKEIPLGLYIYPVLQAADIMLYKATHVPVGEDQVQHLQ
LAQSLARAFNNRFGPTFPFCNPIISDDTSCRLKSLRDPTKKMSKSDPDPKSCIMLTDKAD
VIREKIRKSVTDFTSEVTFEPETRPGVANLLTIHSLASGKSPQQICAEAKGLNTGQYKGL
VADALVAHLEPIRSDIDRYLADPGYLATVIEEGCERARETAERTLHEVKEKVGMNGFSLA
RLSEVARKERVE
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgttcaaaagcttgtcctgtttgaggcttgtgaggccgactgtgcgatatgcatccaca
gaagctatggctccctcctggccccgcaaaatcttctccggcgtccaaccgacaggtgcg
ctccacatcggcaactacctcggcgccatcaagcgctgggtcgacctgcaaaactcgggc
gaggacgtcacgtactgcatcgtcgatctccactcaattacactaccccaggacccggac
ctgctccggcacaacagtctccagatggcggccacgctacttgcttgcggaatcgacccc
gccaagtcgacgctctttttacaatccggagttccgcaacacgcggagctatcttggatt
ctgggctgcatgaccacgatggcgcggctgacgcacttgccacagtacaaggagaagtcg
gcgaagctgaaggagattccgctggggttgtacatctatcctgtgctgcaggccgcggac
attatgctttacaaggcgacgcatgtgcctgtgggtgaggatcaggttcagcatctgcag
ttggcgcagtcactggcgagggcgttcaataaccggtttgggccgacgttcccgttctgt
aatccgatcatttccgacgacaccagttgccggcttaaatcgctccgcgatccaacgaaa
aagatgtccaaatcggatcccgatcccaagagctgcatcatgctgacggacaaagcggac
gtgattcgggaaaagattcgcaaatcggtcaccgactttacctccgaggtaacgttcgag
ccggaaacgcgcccgggtgtggccaacctgctgacgattcactcgctagcgagtgggaaa
agtccgcagcagatttgcgccgaggccaagggattgaacaccggccagtacaagggactg
gtggcggacgcgttggttgcacatctggaaccgattaggagcgatattgaccggtatttg
gcggacccgggctatttggcgacggttattgaggagggttgcgagagggcacgcgagacg
gctgagaggacgctgcacgaggtgaaggaaaaggtaggaatgaatgggtttagcttggcg
cggttatcggaagtggcgaggaaggaacgggttgagtaa

DBGET integrated database retrieval system