KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015285
Entry
CpipJ_CPIJ015285  CDS       T01079                                 

Name
(GenBank) DNA-directed RNA polymerase II 23 kDa polypeptide
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    CpipJ_CPIJ015285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ015285
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ015285
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     CpipJ_CPIJ015285
  RNA polymerase III system
   RNA polymerase III
     CpipJ_CPIJ015285
  RNA polymerase I system
   RNA polymerase I
     CpipJ_CPIJ015285
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      CpipJ_CPIJ015285
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N
Other DBs
NCBI-ProteinID: EDS41858
VectorBase: CPIJ015285
UniProt: B0X7A5
AA seq 210 aa
MDDDAETYKLWRIRKTVMQLSHDRGYLVTQDELDQTLEQFKEQFGDKPSEKRPARSDLIV
LVAHNDDPTDQMFVFFPDEPKIGIKTIKTYCTRMQEENIHRAIVVVQAGMTPSAKQSLVD
MAPKYILEQFLESELLINITEHELVPEHVVMTPEEKQELLARYKLKENMLMRIQAGDPVA
RYFGLKRGQVVKIIRPSETAGRYISYRLVC
NT seq 633 nt   +upstreamnt  +downstreamnt
atggatgatgacgcggagacctacaagctgtggcgaatccgcaaaaccgtgatgcagctc
agccacgatcgaggttatctcgtgacgcaggatgaattggaccagacgttggaacagttc
aaggagcagtttggggacaaaccgagtgaaaagcgtcccgcccggtccgatcttattgtg
ctggtggcgcacaacgacgatccgacggaccagatgtttgtcttcttcccggacgaaccg
aaaatcggcatcaaaaccataaagacgtactgcacccgtatgcaggaggaaaacatccac
cgggccatcgtggtggtccaggccggtatgaccccgtcagcgaagcaatcgctcgtggac
atggccccgaagtacatcctggagcagttcctcgagtcggagctgctgatcaacataacc
gagcacgagctggtgccggaacacgtcgtgatgacgccggaggagaagcaggagctgctg
gcgcgatacaagctcaaggagaacatgctgatgcgaatccaggcgggagatccggtggcg
cgatactttggactgaagcgtggccaggtggtgaaaatcatccgaccctcggaaacggca
ggacggtacatttcctaccgattagtgtgttaa

DBGET integrated database retrieval system