KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015645Help
Entry
CpipJ_CPIJ015645  CDS       T01079                                 

Definition
(RefSeq) hypothetical protein
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqu01001]
    CpipJ_CPIJ015645
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CpipJ_CPIJ015645
Protein kinases [BR:cqu01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   CpipJ_CPIJ015645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo PAXIP1_C
Motif
Other DBs
NCBI-GeneID: 6049136
NCBI-ProteinID: XP_001865944
VectorBase: CPIJ015645
UniProt: B0X8H2
AA seq 359 aa AA seqDB search
MQSLPHSDGQQQRQPKTTPITDDYEISNTVLGLGINGKVVQCTNRKTGAKYALKVLHDNA
KARREVELHWRASGCRNIVNIIDVYENSYSGNRCLLVVMECMLGGELFQRIQERQDGPFT
EREAAQIMHEICVAVKYLHDSNIAHRDLKPENLLYTSPHPNAILKLTDFGFSKETFVKDT
LQTPCYTPYYVAPEVLGPEKYDKSCDIWSLGVIMYILLCGFPPFYSNHGLAISPGMKTRI
RTGQYDFPNPEWQNVSQAAKDLIKGMLSVEPEKRLTIDQVMKNPWVRLYMEVPQTPLHTE
RVLKEGEETWPEVQEEMTRSLANMRVDYDQMHIKNLDSSNNALLNKRRKRGETDAKVKN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccctgccccactcggacggtcagcagcagcggcagcccaagacgacgccgatt
acggacgattacgagatctccaacacggtgctcgggctcggcatcaacgggaaggtggtt
cagtgcaccaaccggaagaccggtgccaagtatgcacttaaggtcctccacgacaacgcc
aaggcccggcgcgaggtggagctgcactggcgcgccagcggctgccggaacatcgtaaac
atcatcgacgtgtacgagaacagctacagcggcaaccggtgcctgttggtcgtcatggaa
tgtatgctcggtggcgaactgttccagcgcatccaggaacgccaggacggaccattcacc
gaacgagaggccgcccaaatcatgcatgagatctgtgtcgctgtgaaatacctgcacgat
tccaacattgcacatcgggacctcaagccggagaatctgctgtacacgtcgccccacccg
aacgccatcctcaaactgaccgattttggcttctcgaaggaaacgttcgtcaaggacacg
ctgcagacgccctgctacacgccgtactacgtcgcgccggaagtcctcgggccggaaaag
tacgacaagagctgtgatatctggtcgctcggcgtcatcatgtacatactactgtgcggc
ttcccgccgttctactccaaccacgggctggccatctccccgggaatgaagacccgcatc
cggaccggccagtacgacttcccgaaccccgagtggcagaacgtgagccaggccgcgaag
gatctcatcaagggcatgctcagcgtcgagcccgagaagcggctgaccatcgatcaggtc
atgaagaacccgtgggttcggttgtacatggaagtgccccagacgccactgcacacggag
cgagtgctgaaggagggtgaagagacctggccggaggtgcaggaagagatgacccggtcg
ctcgccaacatgcgagtggattacgatcagatgcacatcaaaaacctggacagctcaaac
aacgccctgctgaacaagcgaagaaaacggggcgaaacggacgccaaggtgaagaactaa

DBGET integrated database retrieval system